ripD Family assigned · medium auto-curated

H37Rv Rv1566c · MTBC0 mtbc0_001674 · 230 aa · 1785892–1786584 (-) · RefSeq NP_216082.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationNlpC/P60 family peptidoglycan-binding protein RipD
Revised (this work)NlpC/P60 family peptidoglycan-binding protein RipD. Pfam: NLPC_P60 (PF00877.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06624 SwissProt · reviewed · Evidence at protein level
UniProt namePeptidoglycan-binding protein RipD
Curated functionBinds peptidoglycan but does not show peptidoglycan hydrolase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred nameripA_1
eggNOG descriptionCOG0791 Cell wall-associated hydrolases (invasion-associated proteins)
Orthologous groupCOG0791

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.263 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NLPC_P60PF00877.26 9.6e-2555–166 NlpC/P60 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1565c (acyltransferase), high confidence from genomic context alone (score 778 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1477 ripA peptidoglycan endopeptidase RipA 848 834 coexpression:807
Rv1478 ripB peptidoglycan endopeptidase RipB 843 824 coexpression:799
Rv3810 pirG cell surface protein 809 802 coexpression:802
Rv1565c acyltransferase 785 778 ctx neighborhood:774
Rv1158c hyp hypothetical protein 882 751 coexpression:751 textmining:548
Rv2525c hyp hypothetical protein 761 750 coexpression:745
Rv1157c hyp hypothetical protein 759 749 coexpression:748
Rv1564c treX maltooligosyl trehalose synthase 748 748 ctx neighborhood:740
Rv1563c treY maltooligosyl trehalose synthase 740 740 ctx neighborhood:740
Rv1562c treZ malto-oligosyltrehalose trehalohydrolase 740 740 ctx neighborhood:740
Rv2721c hyp hypothetical protein 747 738 coexpression:738
Rv0040c mtc28 hyp hypothetical protein 747 734 coexpression:734
Rv0312 hyp hypothetical protein 730 730 coexpression:730
Rv1567c membrane protein 580 581 ctx neighborhood:581
Rv3414c sigD ECF RNA polymerase sigma factor SigD 487 485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: NlpC/P60 family peptidoglycan-binding protein RipD
  • Pfam (hmmscan --cut_ga): NLPC_P60 PF00877.26 (E=1e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216082.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NLPC_P60 (PF00877.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0791
  • Curated reference: UniProt O06624 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv1565c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001674|Rv1566c|ripD
MKRSMKSGSFAIGLAMMLAPMVAAPGLAAADPATRPVDYQQITDVVIARGLSQRGVPFSWAGGGISGPTRGTGTGINTVGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPEGTQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGTQPTPVQQAPVQPAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQQAPVQPPPFGTARSR