Rv0479c Family assigned · medium auto-curated

H37Rv Rv0479c · MTBC0 mtbc0_000504 · 348 aa · 571286–572332 (-) · RefSeq NP_214993.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationDUF2993 domain-containing protein
Revised (this work)DUF2993 domain-containing protein. Pfam: LmeA (PF11209.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKV7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0479c

UniProt still lists this protein as Uncharacterized protein Rv0479c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2993)
Orthologous group2E4QP
Gene Ontology (14) GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0008150, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0040007, GO:0044425, GO:0044459 +2 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.707 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LmeAPF11209.14 4.7e-19133–326 LmeA-like phospholipid-binding

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0480c (amidohydrolase), high confidence from genomic context alone (score 882 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0480c amidohydrolase 882 882 ctx neighborhood:881
Rv0481c hyp hypothetical protein 876 877 ctx neighborhood:741 cooccurence:544
Rv0227c membrane protein 771 772 ctx cooccurence:760
Rv3810 pirG cell surface protein 767 767 ctx cooccurence:759
Rv1476 membrane protein 767 767 ctx cooccurence:764
Rv0256c PPE2 PPE family protein PPE2 749 749 ctx cooccurence:746
Rv2721c hyp hypothetical protein 745 746 ctx cooccurence:742
Rv1275 lprC lipoprotein LprC 744 745 ctx cooccurence:737
Rv3244c lpqB lipoprotein LpqB 743 744 ctx cooccurence:742
Rv0817c lmeA hyp hypothetical protein 737 737 ctx cooccurence:737
Rv2342 hyp hypothetical protein 732 733 ctx cooccurence:729
Rv2743c hyp hypothetical protein 730 731 ctx cooccurence:729
Rv3668c protease 720 721 ctx cooccurence:720
Rv2719c chiZ membrane protein 719 719 ctx cooccurence:718
Rv3446c hyp hypothetical protein 718 718 ctx cooccurence:717

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: DUF2993 domain-containing protein
  • Pfam (hmmscan --cut_ga): LmeA PF11209.14 (E=5e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214993.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LmeA (PF11209.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E4QP
  • Curated reference: UniProt P9WKV7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 142 functional partner(s); context anchor Rv0480c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000504|Rv0479c|
MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGHIQEPVSPPTQPEQQPQTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKRRARRDPLTVFLVLIIVFSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAPLLLWQVATRHFTNISVETAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITWSSEGIKESVQNAIPILGAFVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIINFNTLGFSLPKETVQSTLNEFTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGIQNPCFSHI