Rv0441c Family assigned · low auto-curated

H37Rv Rv0441c · MTBC0 mtbc0_000463 · 142 aa · 533661–534089 (-) · RefSeq NP_214955.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationpyridoxamine 5'-phosphate oxidase family protein
Revised (this work)Pyridoxamine 5'-phosphate oxidase family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKW3 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0441c

UniProt still lists this protein as Uncharacterized protein Rv0441c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DI8M

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.374 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE10 (PPE family protein PPE10), high confidence from genomic context alone (score 885 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0442c PPE10 PPE family protein PPE10 918 885 ctx neighborhood:846
Rv2482c plsB2 glycerol-3-phosphate acyltransferase 810 802 ctx cooccurence:523 database:549
Rv1551 plsB1 acyltransferase PlsB 697 684 database:549
Rv2721c hyp hypothetical protein 679 680 ctx cooccurence:679
Rv2015c hyp hypothetical protein 669 670 ctx cooccurence:668
Rv3810 pirG cell surface protein 665 666 ctx cooccurence:664
Rv1765c hyp hypothetical protein 635 636 ctx cooccurence:633
Rv3071 hyp hypothetical protein 622 623 ctx cooccurence:622
Rv0443 hyp hypothetical protein 615 615 ctx neighborhood:610
Rv3806c ubiA decaprenyl-phosphate phosphoribosyltransferase 588 567 database:552
Rv0479c membrane protein 562 563 ctx cooccurence:560
Rv1310 atpD ATP synthase subunit beta 572 556 database:538
Rv1305 atpE ATP synthase subunit C 539 540 database:526
Rv1610 membrane protein 533 534 ctx cooccurence:531
Rv2042c hyp hypothetical protein 531 532 ctx cooccurence:523

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: pyridoxamine 5'-phosphate oxidase family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214955.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DI8M
  • Curated reference: UniProt P9WKW3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 60 functional partner(s); context anchor PPE10
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000463|Rv0441c|
MGAKKVDLKRLAAALPDYPFAYLITVDDGHRVHTVAVEPVLRELPDGPDGPRAVVDVGLIGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDDTARCGVVPIRALLHRDAAPDSPTAAKGCLHDCVVFSVP