ripB Family assigned · medium auto-curated

H37Rv Rv1478 · MTBC0 mtbc0_001581 · 241 aa · 1678224–1678949 (+) · RefSeq NP_215994.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)peptidoglycan endopeptidase RipB
MTBC0 PGAP re-annotationNlpC/P60 family peptidoglycan endopeptidase RipB
Revised (this work)NlpC/P60 family peptidoglycan endopeptidase RipB. Pfam: NLPC_P60 (PF00877.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHU5 SwissProt · reviewed · Evidence at protein level
UniProt namePeptidoglycan endopeptidase RipB
EC (curated) EC 3.4.-.-
Curated functionPeptidoglycan endopeptidase that cleaves the bond between D-glutamate and meso-diaminopimelate. Binds high-molecular weight peptidoglycan, but does not degrade it. Required for normal separation of daughter cells after cell division and cell wall integrity. Required for host cell invasion.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred nameripB
eggNOG descriptionPFAM NLP P60 protein
Orthologous groupCOG0791
KEGG orthology K21474
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.726 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.25% of strains (366) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NLPC_P60PF00877.26 4.6e-30124–238 NlpC/P60 family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ripA (peptidoglycan endopeptidase RipA), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1477 ripA peptidoglycan endopeptidase RipA 984 983 ctx neighborhood:874 coexpression:864
Rv1566c ripD hyp hypothetical protein 843 824 coexpression:799
Rv2721c hyp hypothetical protein 803 796 coexpression:796
Rv2154c ftsW lipid II flippase FtsW 768 759 coexpression:759
Rv3810 pirG cell surface protein 754 754 coexpression:754
Rv0312 hyp hypothetical protein 751 751 coexpression:751
Rv1497 lipL esterase LipL 754 746 coexpression:742
Rv0040c mtc28 hyp hypothetical protein 738 738 coexpression:738
Rv1479 moxR1 transcriptional regulator MoxR1 813 736 ctx neighborhood:728
Rv1157c hyp hypothetical protein 634 619 coexpression:618
Rv1481 membrane protein 916 594 ctx neighborhood:575 textmining:803
Rv1480 hyp hypothetical protein 573 573 ctx neighborhood:563
Rv1476 membrane protein 497 497 ctx neighborhood:494
Rv1158c hyp hypothetical protein 441 441 coexpression:441
Rv0063 oxidoreductase 406 406

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: peptidoglycan endopeptidase RipB
  • MTBC0 PGAP product: NlpC/P60 family peptidoglycan endopeptidase RipB
  • Pfam (hmmscan --cut_ga): NLPC_P60 PF00877.26 (E=5e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215994.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NLPC_P60 (PF00877.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0791
  • Curated reference: UniProt P9WHU5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 27 functional partner(s); context anchor ripA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001581|Rv1478|ripB
MRHTRFHPIKLAWITAVVAGLMVGVATPADAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGPSKGVDSGANTVGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGGGQHVTLYLGNGQMLEASGSAGKVTVSPVRKAGMTPFVTRIIEY