Rv2728c Family assigned · low auto-curated · to review

H37Rv Rv2728c · MTBC0 mtbc0_002902 · 231 aa · 3063181–3063876 (-) · RefSeq NP_217244.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)No Pfam domain above threshold; Foldseek indicates a fold similar to 5hee-assembly1_B Crystal structure of the TK2203 protein (prob 1.00, TM 0.73). Structure-based, putative.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt I6X579 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved alanine rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionferrous iron binding
Orthologous groupCOG3885

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.193 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5hee-assembly1_B 1.00 0.73 1.3e-10 sig 5hee-assembly1_B Crystal structure of the TK2203 protein
8ihg-assembly1_D 1.00 0.72 7.5e-08 sig 8ihg-assembly1_D Crystal structure of aminophenol dioxygenase from Pseudomonas species AP-3
7txy-assembly2_E 1.00 0.68 5.5e-08 sig 7txy-assembly2_E Crystal structure of the 2-Aminophenol 1,6-dioxygenase from the ARO bacterial microcompartment of Micromonospora rosaria
3vsj-assembly1_C 1.00 0.68 1.4e-07 sig 3vsj-assembly1_C Crystal structure of 1,6-APD (2-ANIMOPHENOL-1,6-DIOXYGENASE) complexed with intermediate products
3vsg-assembly1_D 1.00 0.69 1.7e-05 sig 3vsg-assembly1_D Crystal structure of iron free 1,6-APD, 2-Animophenol-1,6-Dioxygenase
8ihg-assembly1_C 1.00 0.65 2.1e-05 sig 8ihg-assembly1_C Crystal structure of aminophenol dioxygenase from Pseudomonas species AP-3
8in2-assembly2_B 1.00 0.62 1.5e-05 sig 8in2-assembly2_B 4,5-DOPA-extradiol-dioxygenase from Beta vulgaris
3wrc-assembly1_A 1.00 0.61 2.7e-05 sig 3wrc-assembly1_A Crystal structure of the anaerobic DesB-Protocatechuate (PCA) complex

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: miaA (tRNA delta(2)-isopentenylpyrophosphate transferase), high confidence from genomic context alone (score 889 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2727c miaA tRNA delta(2)-isopentenylpyrophosphate transferase 889 889 ctx neighborhood:882
Rv2726c dapF diaminopimelate epimerase 850 850 ctx neighborhood:849
Rv2725c hflX GTP-binding protein HflX 733 734 ctx neighborhood:733
Rv1486c hyp hypothetical protein 641 641 ctx cooccurence:640
Rv2844 hyp hypothetical protein 619 619 ctx cooccurence:618
Rv1836c hyp hypothetical protein 606 606 ctx cooccurence:606
Rv2729c integral membrane protein 570 570 ctx neighborhood:558
Rv0817c lmeA hyp hypothetical protein 538 539 ctx cooccurence:537
Rv2180c integral membrane protein 513 514 ctx cooccurence:509
Rv3839 hyp hypothetical protein 511 511 ctx cooccurence:511
Rv2731 hyp hypothetical protein 509 509 ctx neighborhood:504
Rv1275 lprC lipoprotein LprC 503 503 ctx cooccurence:503
Rv0479c membrane protein 503 503 ctx cooccurence:503
Rv0227c membrane protein 503 503 ctx cooccurence:503
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 501 501 ctx cooccurence:501

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 5hee-assembly1_B Crystal structure of the TK2203 protein (prob 1.00, E=1e-10, TM=0.73)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217244.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3885
  • Curated reference: UniProt I6X579 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor miaA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002902|Rv2728c|
MLSAIGIVPSAPVLVPELAGAAAAELADLGAAVIAAASLLPKSWIAVGTGRADDVVRPTDVGTFAGFGADVRVGLAPQDGDGVAVPVELPLCALLTAWVRGQARPEARAQVHVYASDHGSDAAVARGRQLRADIDREPDPIGVLVVADGLNTLTPRAPGGYDPDGAGMQRALDDALASGDLAVLTRLPAQVLGRVAFQVLAGLAEPGPRSAKEFYRGAPHGVGYFAGVWQP