dapF Resolved · high auto-curated

H37Rv Rv2726c · MTBC0 mtbc0_002900 · 289 aa · 3061346–3062215 (-) · RefSeq NP_217242.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diaminopimelate epimerase
MTBC0 PGAP re-annotationdiaminopimelate epimerase
Revised (this work)Diaminopimelate epimerase. Pfam: DAP_epimerase (PF01678.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP19 SwissProt · reviewed · Evidence at protein level
UniProt nameDiaminopimelate epimerase
EC (curated) EC 5.1.1.7
Curated functionCatalyzes the stereoinversion of LL-2,6-diaminopimelate (L,L-DAP) to meso-diaminopimelate (meso-DAP), a precursor of L-lysine and an essential component of the bacterial peptidoglycan.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namedapF
eggNOG descriptionCatalyzes the stereoinversion of LL-2,6- diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso- DAP), a precursor of L-lysine and an essential component of the bacterial peptidoglycan
Orthologous groupCOG0253
EC number EC 5.1.1.7
KEGG orthology K01778
KEGG pathways map00300, map01100, map01110, map01120, map01130, map01230
KEGG modules M00016, M00525, M00527
Gene Ontology (50) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0006520, GO:0006553, GO:0006807 +38 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DAP_epimerasePF01678.25 9.1e-303–141 Diaminopimelate epimerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lysA (diaminopimelate decarboxylase), high confidence from genomic context alone (score 972 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1293 lysA diaminopimelate decarboxylase 996 972 ctx cooccurence:643 database:900 textmining:886
Rv1202 dapE succinyl-diaminopimelate desuccinylase DapE 997 959 ctx cooccurence:557 database:900 textmining:949
Rv2158c murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase 979 926 database:900 textmining:730
Rv2727c miaA tRNA delta(2)-isopentenylpyrophosphate transferase 850 850 ctx neighborhood:849
Rv2728c hyp hypothetical protein 850 850 ctx neighborhood:849
Rv2725c hflX GTP-binding protein HflX 927 817 ctx neighborhood:808 textmining:623
Rv3708c asd aspartate-semialdehyde dehydrogenase 969 767 coexpression:677 textmining:875
Rv2773c dapB 4-hydroxy-tetrahydrodipicolinate reductase 969 731 ctx cooccurence:708 textmining:890
Rv2753c dapA 4-hydroxy-tetrahydrodipicolinate synthase 965 730 ctx cooccurence:697 textmining:877
Rv3859c gltB glutamate synthase large subunit 835 724 ctx neighborhood:544 coexpression:420 textmining:426
Rv1178 dapC aminotransferase 898 685 ctx cooccurence:581 textmining:691
Rv1384 carB carbamoyl-phosphate synthase large subunit 609 593 ctx fusion:560
Rv3709c ask aspartokinase 932 509 ctx cooccurence:437 textmining:868
Rv2729c integral membrane protein 524 504 ctx neighborhood:503
Rv2731 hyp hypothetical protein 491 491 ctx neighborhood:483

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: diaminopimelate epimerase
  • MTBC0 PGAP product: diaminopimelate epimerase
  • Pfam (hmmscan --cut_ga): DAP_epimerase PF01678.25 (E=9e-30)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217242.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DAP_epimerase (PF01678.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0253
  • Curated reference: UniProt P9WP19 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 54 functional partner(s); context anchor lysA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002900|Rv2726c|dapF
MIFAKGHGTQNDFVLLPDVDAELVLTAARVAALCDRRKGLGADGVLRVTTAGAAQAVGVLDSLPEGVRVTDWYMDYRNADGSAAQMCGNGVRVFAHYLRASGLEVRDEFVVGSLAGPRPVTCHHVEAAYADVSVDMGKANRLGAGEAVVGGRRFHGLAVDVGNPHLACVDSQLTVDGLAALDVGAPVSFDGAQFPDGVNVEVLTAPVDGAVWMRVHERGVGETRSCGTGTVAAAVAALAAVGSPTGTLTVHVPGGEVVVTVTDATSFLRGPSVLVARGDLADDWWNAMG