Rv1157c Still unknown · low auto-curated
H37Rv Rv1157c · MTBC0 mtbc0_001245 ·
371 aa · 1291497–1292612 (-) ·
RefSeq NP_215673.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlam (prob 0.04, TM 0.08). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06555
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved ala-, pro-rich protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2CDJB |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.231 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 82.7 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
8glv-assembly1_Gs |
0.04 | 0.08 | 5.3e-01 | 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella |
6u42-assembly1_5F |
0.03 | 0.07 | 6.2e-01 | 6u42-assembly1_5F Natively decorated ciliary doublet microtubule |
6sjl-assembly1_C |
0.02 | 0.10 | 2.3e+00 | 6sjl-assembly1_C Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: pimE (polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase), high confidence from genomic context alone (score 735 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1158c hyp |
hypothetical protein | 990 | 973 ctx | neighborhood:817 coexpression:858 textmining:655 |
Rv2721c hyp |
hypothetical protein | 798 | 799 | coexpression:730 |
Rv2737A |
Rv2737A, len: 57 aa. Conserved hypothetical cys-rich protein (possibly gene fragment), similar to central part of AJ243803_1|glgA from Strep | 792 | 784 | coexpression:778 |
Rv1477 ripA |
peptidoglycan endopeptidase RipA | 830 | 776 | coexpression:769 |
Rv3810 pirG |
cell surface protein | 775 | 774 | coexpression:733 |
Rv2154c ftsW |
lipid II flippase FtsW | 764 | 764 | coexpression:761 |
Rv1566c ripD hyp |
hypothetical protein | 759 | 749 | coexpression:748 |
Rv1159 pimE |
polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase | 735 | 735 ctx | neighborhood:561 cooccurence:418 |
Rv3882c eccE1 |
ESX-1 secretion system protein EccE1 | 708 | 709 ctx | cooccurence:707 |
Rv3201c adnB |
ATP-dependent DNA helicase | 885 | 703 ctx | cooccurence:698 textmining:631 |
Rv3091 hyp |
hypothetical protein | 702 | 702 ctx | cooccurence:697 |
Rv3869 eccB1 |
ESX-1 secretion system protein EccB | 711 | 701 ctx | cooccurence:693 |
Rv2098c PE_PGRS36 |
PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub | 695 | 696 ctx | cooccurence:691 |
Rv1651c PE_PGRS30 |
PE-PGRS family protein PE_PGRS30 | 706 | 695 ctx | cooccurence:689 |
Rv3877 eccD1 |
ESX-1 secretion system protein EccD1 | 691 | 691 ctx | cooccurence:689 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlamydomonas r (prob 0.04, E=5e-01, TM=0.08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215673.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2CDJB - Curated reference: UniProt O06555 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 82.7, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
106 functional partner(s); context anchor
pimE - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001245|Rv1157c| MRRLTNTEHRENTTVASTWSVCKGLAAVVITSAAAFALCPNAAADPATPQPNPTQQLPGLPALAQLSPIIQQAAMNPAQATQLLMAAASAFAGNPAVPTESKNVASSVNQFVAEPTNPDSAALGVPAPHGVALPEAIPVPHVPPLGAEPGVQAHLPTGIDPSHAAGPAPAVAPTVTPPVAAPPASAPAPAPDAAQPVAVPGPPPAPPAPRAAAPAPASAAPAPAAAPAPASGFGADAPPTQDFMYPSIGPNCVADGSNSIATALSVAGPAKIPLPGPGPGQTAYVFTAVGTPGPADVQRLPLNVTWVNLTTGKSGSATLRPRSDINPDGPTTLTVIADTGSGSIMSTIFGQVTTKDRQCQFMPTIGSTVVP