Rv1157c Still unknown · low auto-curated

H37Rv Rv1157c · MTBC0 mtbc0_001245 · 371 aa · 1291497–1292612 (-) · RefSeq NP_215673.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlam (prob 0.04, TM 0.08).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06555 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved ala-, pro-rich protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2CDJB

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.231 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 82.7 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8glv-assembly1_Gs 0.04 0.08 5.3e-01 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlamydomonas reinhardtii flagella
6u42-assembly1_5F 0.03 0.07 6.2e-01 6u42-assembly1_5F Natively decorated ciliary doublet microtubule
6sjl-assembly1_C 0.02 0.10 2.3e+00 6sjl-assembly1_C Structure of the Tle1 effector bound to the VgrG spike from the Type 6 secretion system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pimE (polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase), high confidence from genomic context alone (score 735 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1158c hyp hypothetical protein 990 973 ctx neighborhood:817 coexpression:858 textmining:655
Rv2721c hyp hypothetical protein 798 799 coexpression:730
Rv2737A Rv2737A, len: 57 aa. Conserved hypothetical cys-rich protein (possibly gene fragment), similar to central part of AJ243803_1|glgA from Strep 792 784 coexpression:778
Rv1477 ripA peptidoglycan endopeptidase RipA 830 776 coexpression:769
Rv3810 pirG cell surface protein 775 774 coexpression:733
Rv2154c ftsW lipid II flippase FtsW 764 764 coexpression:761
Rv1566c ripD hyp hypothetical protein 759 749 coexpression:748
Rv1159 pimE polyprenol-phosphate-mannose-dependent alpha-(1-2)-phosphatidylinositol pentamannoside mannosyltransferase 735 735 ctx neighborhood:561 cooccurence:418
Rv3882c eccE1 ESX-1 secretion system protein EccE1 708 709 ctx cooccurence:707
Rv3201c adnB ATP-dependent DNA helicase 885 703 ctx cooccurence:698 textmining:631
Rv3091 hyp hypothetical protein 702 702 ctx cooccurence:697
Rv3869 eccB1 ESX-1 secretion system protein EccB 711 701 ctx cooccurence:693
Rv2098c PE_PGRS36 PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub 695 696 ctx cooccurence:691
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 706 695 ctx cooccurence:689
Rv3877 eccD1 ESX-1 secretion system protein EccD1 691 691 ctx cooccurence:689

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 8glv-assembly1_Gs 96-nm repeat unit of doublet microtubules from Chlamydomonas r (prob 0.04, E=5e-01, TM=0.08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215673.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2CDJB
  • Curated reference: UniProt O06555 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 82.7, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 106 functional partner(s); context anchor pimE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001245|Rv1157c|
MRRLTNTEHRENTTVASTWSVCKGLAAVVITSAAAFALCPNAAADPATPQPNPTQQLPGLPALAQLSPIIQQAAMNPAQATQLLMAAASAFAGNPAVPTESKNVASSVNQFVAEPTNPDSAALGVPAPHGVALPEAIPVPHVPPLGAEPGVQAHLPTGIDPSHAAGPAPAVAPTVTPPVAAPPASAPAPAPDAAQPVAVPGPPPAPPAPRAAAPAPASAAPAPAAAPAPASGFGADAPPTQDFMYPSIGPNCVADGSNSIATALSVAGPAKIPLPGPGPGQTAYVFTAVGTPGPADVQRLPLNVTWVNLTTGKSGSATLRPRSDINPDGPTTLTVIADTGSGSIMSTIFGQVTTKDRQCQFMPTIGSTVVP