argR Resolved · high auto-curated

H37Rv Rv1657 · MTBC0 mtbc0_001766 · 170 aa · 1882884–1883396 (+) · RefSeq NP_216173.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)arginine repressor
MTBC0 PGAP re-annotationarginine repressor
Revised (this work)Arginine repressor. Pfam: Arg_repressor (PF01316.28), Arg_repressor_C (PF02863.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPY9 SwissProt · reviewed · Evidence at protein level
UniProt nameArginine repressor
Curated functionRegulates arginine biosynthesis genes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameargR
eggNOG descriptionRegulates arginine biosynthesis genes
Orthologous groupCOG1438
KEGG orthology K03402
Gene Ontology (53) GO:0000976, GO:0001067, GO:0001130, GO:0001216, GO:0003674, GO:0003676, GO:0003677, GO:0003690, GO:0003700, GO:0005488, GO:0005575, GO:0006355 +41 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.26 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Arg_repressorPF01316.28 1.3e-2516–85 Arginine repressor, DNA binding domain
Arg_repressor_CPF02863.24 1.5e-24102–167 Arginine repressor, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: argJ (bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1653 argJ bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase 999 998 ctx neighborhood:881 coexpression:985 textmining:931
Rv1654 argB acetylglutamate kinase 999 996 ctx neighborhood:881 coexpression:968 textmining:931
Rv1655 argD acetylornithine aminotransferase 998 988 ctx neighborhood:882 coexpression:905 textmining:915
Rv1658 argG argininosuccinate synthase 997 988 ctx neighborhood:879 coexpression:908 textmining:799
Rv1656 argF ornithine carbamoyltransferase 997 987 ctx neighborhood:882 coexpression:892 textmining:804
Rv1652 argC N-acetyl-gamma-glutamyl-phoshate reductase 997 986 ctx neighborhood:881 coexpression:888 textmining:811
Rv1659 argH argininosuccinate lyase 994 981 ctx neighborhood:783 coexpression:915 textmining:735
Rv1661 pks7 polyketide synthase 627 611 ctx neighborhood:588
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 684 561 ctx neighborhood:544
Rv1649 pheS phenylalanine--tRNA ligase subunit alpha 607 548 ctx neighborhood:544
Rv1647 adenylate cyclase 520 521 ctx neighborhood:518
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 498 498 ctx neighborhood:498
Rv3859c gltB glutamate synthase large subunit 629 478 ctx neighborhood:475
Rv2322c rocD1 Rv2322c, (MTCY3G12.12), len: 221 aa. Probable rocD1,ornithine aminotransferase, highly similar to N-terminal region of other ornithine amino 535 465 coexpression:426
Rv2321c rocD2 Rv2321c, (MTCY3G12.13), len: 181 aa. Probable rocD2,ornithine aminotransferase, highly similar to C-terminal region of other ornithine amino 534 464 coexpression:425

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: arginine repressor
  • MTBC0 PGAP product: arginine repressor
  • Pfam (hmmscan --cut_ga): Arg_repressor PF01316.28 (E=1e-25), Arg_repressor_C PF02863.24 (E=1e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216173.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Arg_repressor (PF01316.28), Arg_repressor_C (PF02863.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1438
  • Curated reference: UniProt P9WPY9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor argJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001766|Rv1657|argR
MSRAKAAPVAGPEVAANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR