Rv0052 Family assigned · medium auto-curated

H37Rv Rv0052 · MTBC0 - · 187 aa · 57410–57973 (+) · RefSeq NP_214566.3

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains DJ-1_PfpI (PF01965.31) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6Y6S3 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDJ-1 PfpI family
Orthologous groupCOG0693

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DJ-1_PfpIPF01965.31 2.5e-204–140 DJ-1/PfpI family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0051 (transmembrane protein), high confidence from genomic context alone (score 938 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0051 transmembrane protein 937 938 ctx neighborhood:722 coexpression:785
Rv0050 ponA1 bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase 734 735 ctx neighborhood:722
Rv1931c transcriptional regulator 656 656 ctx cooccurence:644
Rv0053 rpsF 30S ribosomal protein S6 465 466 ctx neighborhood:466
Rv2720 lexA repressor LexA 452 450
Rv2703 sigA RNA polymerase sigma factor SigA 463 435
Rv2710 sigB RNA polymerase sigma factor SigB 463 434
Rv2043c pncA pyrazinamidase/nicotinamidase PncA 426 427 coexpression:405
Rv2074 pyridoxamine 5'-phosphate oxidase 406 407
Rv2025c cation efflux system protein 447 155
Rv2704 hyp hypothetical protein 527 61 textmining:517
Rv3256c hyp hypothetical protein 522 55 textmining:516
Rv3916c hyp hypothetical protein 444 55 textmining:436
Rv3192 hyp hypothetical protein 871 51 textmining:870
Rv1775 hyp hypothetical protein 403 46 textmining:400

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): DJ-1_PfpI PF01965.31 (E=2e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214566.3)
  • Domains: Pfam-A via hmmscan --cut_ga — DJ-1_PfpI (PF01965.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0693
  • Curated reference: UniProt I6Y6S3 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv0051
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0052|
MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGGIGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNSLGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPVDAGSLAKASPATHRLALEFYQHRL