Rv1931c Family assigned · medium auto-curated

H37Rv Rv1931c · MTBC0 - · 259 aa · 2182460–2183239 (-) · RefSeq NP_216447.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional regulator
MTBC0 PGAP re-annotation
Revised (this work)Transcriptional regulator. Pfam: DJ-1_PfpI (PF01965.31), HTH_18 (PF12833.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P95283 SwissProt · reviewed · Evidence at transcript level
UniProt nameHTH-type transcriptional regulator Rv1931c
Curated functionControls the expression of genes important for virulence.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG4977
Gene Ontology (22) GO:0005575, GO:0005623, GO:0005886, GO:0008150, GO:0009405, GO:0010468, GO:0010565, GO:0016020, GO:0019216, GO:0019217, GO:0019222, GO:0031323 +10 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.89 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DJ-1_PfpIPF01965.31 8.4e-0711–62 DJ-1/PfpI family
HTH_18PF12833.14 4.9e-23178–256 Helix-turn-helix domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: sigI (ECF RNA polymerase sigma factor SigI), high confidence from genomic context alone (score 905 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1930c hyp hypothetical protein 935 935 ctx neighborhood:863 cooccurence:539
Rv1725c hyp hypothetical protein 910 911 coexpression:860
Rv1189 sigI ECF RNA polymerase sigma factor SigI 908 905 ctx cooccurence:489 coexpression:822
Rv3082c virS HTH-type transcriptional regulator VirS 888 883 coexpression:831
Rv2488c LuxR family transcriptional regulator 885 879 coexpression:857
Rv3736 AraC/XylS family transcriptional regulator 884 879 coexpression:831
Rv3167c TetR family transcriptional regulator 877 878 coexpression:860
Rv3328c sigJ ECF RNA polymerase sigma factor SigJ 880 876 ctx cooccurence:524 coexpression:751
Rv0212c nadR transcriptional regulator NadR 865 866 coexpression:846
Rv1674c transcriptional regulator 864 864 coexpression:862
Rv1190 hyp hypothetical protein 863 864 coexpression:841
Rv0117 oxyS oxidative stress response regulatory protein OxyS 865 860 coexpression:860
Rv1267c embR transcriptional regulator EmbR 862 860 coexpression:860
Rv1675c cmr HTH-type transcriptional regulator Cmr 861 860 coexpression:860
Rv0494 HTH-type transcriptional regulator 860 860 coexpression:827

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transcriptional regulator
  • Pfam (hmmscan --cut_ga): DJ-1_PfpI PF01965.31 (E=8e-07), HTH_18 PF12833.14 (E=5e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216447.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DJ-1_PfpI (PF01965.31), HTH_18 (PF12833.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4977
  • Curated reference: UniProt P95283 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 93 functional partner(s); context anchor sigI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1931c|
MVIVGFPGDPVDTVILPGGAGVDAARSEPALIDWVKAVSGTARRVVTVCTGAFLAAEAGLLGRTPSDDALGLCRTFRPRISGRSGRCRPDLHAQFAEGVDRGWSHRRHRPRAGTGRRRPRHRDCPDGCPLARPVSAPTRWADPVRGSGVDATRQTDLDPPGAGGHRGRAGGAHRIGELAQRAAMSPRHFTRVFSDEVGEAPGRYVERIRTEAARRQLEETHDTVVAIAARCGFGTAETMRRSFIRRVGISPDQYRKAFA