Rv2862c Still unknown · low auto-curated

H37Rv Rv2862c · MTBC0 mtbc0_003043 · 194 aa · 3194725–3195309 (-) · RefSeq NP_217378.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF1707 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF1707. Function unknown. Foldseek best (non-significant) hit: 7yh8-assembly2_C Crystal structure of a heterochiral protein complex (prob 0.69, TM 0.74).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y1W7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF1707 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF1707)
Orthologous groupCOG4758

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.493 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF1707PF08044.17 6.3e-1711–63 DUF1707 SHOCT-like domain

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.9 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7yh8-assembly2_C 0.69 0.74 3.0e+00 7yh8-assembly2_C Crystal structure of a heterochiral protein complex
9ir4-assembly1_C 0.63 0.65 2.6e+00 9ir4-assembly1_C Cryo-EM structure of Nipah virus L-P (H1165Y) polymerase complex
9ir3-assembly1_C 0.54 0.78 5.2e+00 9ir3-assembly1_C Cryo-EM structure of Nipah virus L-P polymerase complex
4kjm-assembly1_A 0.47 0.80 6.2e+00 4kjm-assembly1_A Crystal structure of the Staphylococcus aureus protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB
4kjm-assembly1_B 0.25 0.63 5.0e+00 4kjm-assembly1_B Crystal structure of the Staphylococcus aureus protein (NP_646141.1, domain 3912-4037) similar to streptococcal adhesins emb and ebhA/ebhB
7puk-assembly2_C 0.21 0.64 6.5e+00 7puk-assembly2_C Crystal structure of Endoglycosidase E GH18 domain from Enterococcus faecalis in complex with Man5 product
7oyd-assembly1_R 0.15 0.59 8.6e+00 7oyd-assembly1_R Cryo-EM structure of a rabbit 80S ribosome with zebrafish Dap1b
7bqn-assembly1_A 0.11 0.57 9.1e+00 7bqn-assembly1_A Solution NMR structure of fold-C Rei; de novo designed protein with an asymmetric all-alpha topology

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mapB (methionine aminopeptidase), medium confidence from genomic context alone (score 689 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2861c mapB methionine aminopeptidase 689 689 ctx neighborhood:687
Rv0320 hyp hypothetical protein 686 687 ctx cooccurence:673
Rv2712c hyp hypothetical protein 617 618 ctx cooccurence:617
Rv1728c hyp hypothetical protein 584 584 ctx cooccurence:584
Rv3682 ponA2 bifunctional penicillin-insensitive transglycosylase/penicillin-sensitive transpeptidase 582 583 coexpression:426
Rv2863 vapC23 ribonuclease VapC23 543 543 ctx neighborhood:543
Rv2862A vapB23 antitoxin VapB23 543 543 ctx neighborhood:543
Rv3660c ssd hyp hypothetical protein 539 539 ctx cooccurence:539
Rv2980 hyp hypothetical protein 507 507 ctx cooccurence:507
Rv0845 narS sensor histidine kinase NarS 520 500 coexpression:483
Rv3132c devS two component sensor histidine kinase DevS 519 499 coexpression:482
Rv2027c dosT two component sensor histidine kinase DosT 519 499 coexpression:482
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 482 482 ctx cooccurence:482
Rv3753c hyp hypothetical protein 476 477 ctx cooccurence:475
Rv2721c hyp hypothetical protein 472 456 ctx cooccurence:456

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF1707 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF1707 PF08044.17 (E=6e-17)
  • Foldseek best: 7yh8-assembly2_C Crystal structure of a heterochiral protein complex (prob 0.69, E=3e+00, TM=0.74)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217378.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF1707 (PF08044.17)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4758
  • Curated reference: UniProt I6Y1W7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.9, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor mapB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003043|Rv2862c|
MTETGGDMVALRVSDADRNGTMRRLHNAVALGLINIDEFEQRSSRVSFARTRSELDGLVGDLPRPGAIVTSAADRVELRGWAGSLKRHGEWIVPTRLALVRRLGSIELDLVKARFAGPVVVIELDMMFGSLEVRLPNGASASIDDVEVYVGSASDRRKDAPAEGTPHVVLTGRMVCGSVVIKGPRRALLRRHRG