lmeA Resolved · high auto-curated
H37Rv Rv0817c · MTBC0 mtbc0_000866 ·
270 aa · 913097–913909 (-) ·
RefSeq NP_215332.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | mannan chain length control protein LmeA |
| Revised (this work) | Mannan chain length control protein LmeA. Pfam: LmeA (PF11209.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6WZH9
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved exported protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF2993) |
| Orthologous group | 2DR5D |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.35 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LmeA | PF11209.14 | 1.5e-27 | 26–255 | LmeA-like phospholipid-binding |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: thiX (thioredoxin ThiX), high confidence from genomic context alone (score 883 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0816c thiX |
thioredoxin ThiX | 976 | 883 ctx | neighborhood:882 textmining:806 |
Rv0383c ttfA hyp |
hypothetical protein | 773 | 773 ctx | cooccurence:773 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 764 | 764 ctx | cooccurence:764 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 761 | 761 ctx | cooccurence:761 |
Rv1275 lprC |
lipoprotein LprC | 761 | 761 ctx | cooccurence:761 |
Rv2743c hyp |
hypothetical protein | 759 | 759 ctx | cooccurence:759 |
Rv0996 |
transmembrane protein | 755 | 756 ctx | cooccurence:755 |
Rv1610 |
membrane protein | 752 | 753 ctx | cooccurence:752 |
Rv1166 lpqW |
monoacyl phosphatidylinositol tetramannoside-binding protein LpqW | 751 | 751 ctx | cooccurence:751 |
Rv3850 hyp |
hypothetical protein | 751 | 751 ctx | cooccurence:751 |
Rv2672 |
protease | 750 | 751 ctx | cooccurence:750 |
Rv0556 |
transmembrane protein | 749 | 750 ctx | cooccurence:749 |
Rv3707c hyp |
hypothetical protein | 748 | 749 ctx | cooccurence:747 |
Rv3035 hyp |
hypothetical protein | 748 | 748 ctx | cooccurence:748 |
Rv0466 hyp |
hypothetical protein | 747 | 748 ctx | cooccurence:747 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: mannan chain length control protein LmeA
- Pfam (hmmscan --cut_ga): LmeA PF11209.14 (E=2e-27)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215332.1)
- Domains: Pfam-A via hmmscan --cut_ga — LmeA (PF11209.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DR5D - Curated reference: UniProt I6WZH9 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
136 functional partner(s); context anchor
thiX - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000866|Rv0817c|lmeA MPMRKVLVGVTGAAIVVAVLIVGAVGADFGASIYAEYRLSTTVRKAANLRSDPFVAILRFPFIPQAMREHYAELEIKAFAVEHAGSGTATLEATMHSIDLSYASWLIRPDAKLPVGELESRIIIDSMHLGRYLGISDLMVAAPRQESNDATGGTTESGISGSRGLVFSGTPISANFAHRVSVLVDLSVASDDRATLVITPTAVVTGPDTADQPVPDDKRDAVLHAFASKLPNQKLPFGVVPNTVGARGSDVIIEGITRGVTISLDEFKQS