lmeA Resolved · high auto-curated

H37Rv Rv0817c · MTBC0 mtbc0_000866 · 270 aa · 913097–913909 (-) · RefSeq NP_215332.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmannan chain length control protein LmeA
Revised (this work)Mannan chain length control protein LmeA. Pfam: LmeA (PF11209.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6WZH9 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2993)
Orthologous group2DR5D

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.35 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LmeAPF11209.14 1.5e-2726–255 LmeA-like phospholipid-binding

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thiX (thioredoxin ThiX), high confidence from genomic context alone (score 883 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0816c thiX thioredoxin ThiX 976 883 ctx neighborhood:882 textmining:806
Rv0383c ttfA hyp hypothetical protein 773 773 ctx cooccurence:773
Rv0475 hbhA heparin binding hemagglutinin HbhA 764 764 ctx cooccurence:764
Rv0290 eccD3 ESX-3 secretion system protein EccD 761 761 ctx cooccurence:761
Rv1275 lprC lipoprotein LprC 761 761 ctx cooccurence:761
Rv2743c hyp hypothetical protein 759 759 ctx cooccurence:759
Rv0996 transmembrane protein 755 756 ctx cooccurence:755
Rv1610 membrane protein 752 753 ctx cooccurence:752
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 751 751 ctx cooccurence:751
Rv3850 hyp hypothetical protein 751 751 ctx cooccurence:751
Rv2672 protease 750 751 ctx cooccurence:750
Rv0556 transmembrane protein 749 750 ctx cooccurence:749
Rv3707c hyp hypothetical protein 748 749 ctx cooccurence:747
Rv3035 hyp hypothetical protein 748 748 ctx cooccurence:748
Rv0466 hyp hypothetical protein 747 748 ctx cooccurence:747

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: mannan chain length control protein LmeA
  • Pfam (hmmscan --cut_ga): LmeA PF11209.14 (E=2e-27)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215332.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LmeA (PF11209.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DR5D
  • Curated reference: UniProt I6WZH9 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 136 functional partner(s); context anchor thiX
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000866|Rv0817c|lmeA
MPMRKVLVGVTGAAIVVAVLIVGAVGADFGASIYAEYRLSTTVRKAANLRSDPFVAILRFPFIPQAMREHYAELEIKAFAVEHAGSGTATLEATMHSIDLSYASWLIRPDAKLPVGELESRIIIDSMHLGRYLGISDLMVAAPRQESNDATGGTTESGISGSRGLVFSGTPISANFAHRVSVLVDLSVASDDRATLVITPTAVVTGPDTADQPVPDDKRDAVLHAFASKLPNQKLPFGVVPNTVGARGSDVIIEGITRGVTISLDEFKQS