rseA Resolved · medium auto-curated

H37Rv Rv1222 · MTBC0 mtbc0_001310 · 154 aa · 1373786–1374250 (+) · RefSeq NP_215738.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)anti-sigma E factor RseA
MTBC0 PGAP re-annotationanti-sigma E factor RseA
Revised (this work)Anti-sigma E factor RseA.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt L0T905 SwissProt · reviewed · Evidence at protein level
UniProt nameAnti-sigma-E factor RseA
Curated functionAn anti-sigma factor for extracytoplasmic function (ECF) sigma factor SigE. ECF sigma factors are held in an inactive form by an anti-sigma factor.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namerseA
eggNOG descriptionnucleic acid-templated transcription
Orthologous groupCOG5662

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.356 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (178) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tatB (Sec-independent protein translocase protein TatB), high confidence from genomic context alone (score 804 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1224 tatB Sec-independent protein translocase protein TatB 804 804 ctx neighborhood:659
Rv1221 sigE ECF RNA polymerase sigma factor SigE 859 789 ctx neighborhood:614
Rv1223 htrA serine protease HtrA 776 773 ctx neighborhood:659
Rv1109c hyp hypothetical protein 770 770 ctx cooccurence:769
Rv2520c membrane protein 770 770 ctx cooccurence:770
Rv1083 hyp hypothetical protein 761 761 ctx cooccurence:760
Rv0475 hbhA heparin binding hemagglutinin HbhA 753 754 ctx cooccurence:750
Rv3004 cfp6 low molecular weight protein antigen 6 753 754 ctx cooccurence:751
Rv2468c hyp hypothetical protein 749 749 ctx cooccurence:740
Rv3311 hyp hypothetical protein 748 749 ctx cooccurence:748
Rv2091c membrane protein 744 745 ctx cooccurence:741
Rv3212 hyp hypothetical protein 736 736 ctx cooccurence:734
Rv0876c transmembrane protein 735 736 ctx cooccurence:732
Rv1111c hyp hypothetical protein 724 724 ctx cooccurence:724
Rv2700 cei hyp hypothetical protein 718 718 ctx cooccurence:718

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: anti-sigma E factor RseA
  • MTBC0 PGAP product: anti-sigma E factor RseA
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215738.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5662
  • Curated reference: UniProt L0T905 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 122 functional partner(s); context anchor tatB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001310|Rv1222|rseA
MADPGSVGHVFRRAFSWLPAQFASQSDAPVGAPRQFRSTEHLSIEAIAAFVDGELRMNAHLRAAHHLSLCAQCAAEVDDQSRARAALRDSHPIRIPSTLLGLLSEIPRCPPEGPSKGSSGGSSQGPPDGAAAGFGDRFADGDGGNRGRQSRVRR