Rv2743c Family assigned · medium auto-curated
H37Rv Rv2743c · MTBC0 mtbc0_002920 ·
270 aa · 3078835–3079647 (-) ·
RefSeq NP_217259.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Contains Rv2743c (PF25587.2) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6YA50
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative envelope-preserving system protein Rv2743c |
| Curated function | Involved in preservation of envelope integrity and tolerance to surface stress. Reverses the inhibitory effect of PspA on ClgR activity. Facilitates intracellular growth of M.tuberculosis. |
UniProt still lists this protein as Putative envelope-preserving system protein Rv2743c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2FK8T |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.289 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Rv2743c | PF25587.2 | 2.2e-81 | 24–264 | Rv2743c family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: lppL (lipoprotein LppL), high confidence from genomic context alone (score 765 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2744c 35kd_ag hyp |
hypothetical protein | 971 | 860 ctx | neighborhood:799 textmining:804 |
Rv2138 lppL |
lipoprotein LppL | 765 | 765 ctx | cooccurence:765 |
Rv3810 pirG |
cell surface protein | 762 | 762 ctx | cooccurence:760 |
Rv2719c chiZ |
membrane protein | 761 | 761 ctx | cooccurence:760 |
Rv0817c lmeA hyp |
hypothetical protein | 759 | 759 ctx | cooccurence:759 |
Rv3707c hyp |
hypothetical protein | 753 | 753 ctx | cooccurence:752 |
Rv1486c hyp |
hypothetical protein | 753 | 753 ctx | cooccurence:750 |
Rv0996 |
transmembrane protein | 752 | 753 ctx | cooccurence:749 |
Rv0383c ttfA hyp |
hypothetical protein | 744 | 744 ctx | cooccurence:744 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 742 | 743 ctx | cooccurence:739 |
Rv3593 lpqF |
lipoprotein LpqF | 742 | 742 ctx | cooccurence:740 |
Rv3527 hyp |
hypothetical protein | 736 | 737 ctx | cooccurence:735 |
Rv3415c hyp |
hypothetical protein | 732 | 732 ctx | cooccurence:731 |
Rv0479c |
membrane protein | 730 | 731 ctx | cooccurence:729 |
Rv1836c hyp |
hypothetical protein | 729 | 730 ctx | cooccurence:727 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): Rv2743c PF25587.2 (E=2e-81)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217259.1)
- Domains: Pfam-A via hmmscan --cut_ga — Rv2743c (PF25587.2)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2FK8T - Curated reference: UniProt I6YA50 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
107 functional partner(s); context anchor
lppL - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002920|Rv2743c| MAVKAGQRRPWRSLLQRGVDTAGDLADLVAQKISVAIDPRARLLRRRRRALRWGLVFTAGCLLWGLVTALLAAWGWFTSLLVITGTIAVTQAIPATLLLLRYRWLRSEPLPVRRPASVRRLPPPGSAARPAMSALGASERGFFSLLGVMERGAMLPADEIRDLTAAANQTSAAMVATAAEVVSMERAVQCSAASRSYLVPTINAFTAQLSTGVRQYNEMVTAAAQLVSSANGAGGAGPGQQRYREELAGATDRLVAWAQAFDELGGLPRR