Rv2743c Family assigned · medium auto-curated

H37Rv Rv2743c · MTBC0 mtbc0_002920 · 270 aa · 3078835–3079647 (-) · RefSeq NP_217259.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Contains Rv2743c (PF25587.2) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YA50 SwissProt · reviewed · Evidence at protein level
UniProt namePutative envelope-preserving system protein Rv2743c
Curated functionInvolved in preservation of envelope integrity and tolerance to surface stress. Reverses the inhibitory effect of PspA on ClgR activity. Facilitates intracellular growth of M.tuberculosis.

UniProt still lists this protein as Putative envelope-preserving system protein Rv2743c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2FK8T

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.289 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv2743cPF25587.2 2.2e-8124–264 Rv2743c family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lppL (lipoprotein LppL), high confidence from genomic context alone (score 765 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2744c 35kd_ag hyp hypothetical protein 971 860 ctx neighborhood:799 textmining:804
Rv2138 lppL lipoprotein LppL 765 765 ctx cooccurence:765
Rv3810 pirG cell surface protein 762 762 ctx cooccurence:760
Rv2719c chiZ membrane protein 761 761 ctx cooccurence:760
Rv0817c lmeA hyp hypothetical protein 759 759 ctx cooccurence:759
Rv3707c hyp hypothetical protein 753 753 ctx cooccurence:752
Rv1486c hyp hypothetical protein 753 753 ctx cooccurence:750
Rv0996 transmembrane protein 752 753 ctx cooccurence:749
Rv0383c ttfA hyp hypothetical protein 744 744 ctx cooccurence:744
Rv0290 eccD3 ESX-3 secretion system protein EccD 742 743 ctx cooccurence:739
Rv3593 lpqF lipoprotein LpqF 742 742 ctx cooccurence:740
Rv3527 hyp hypothetical protein 736 737 ctx cooccurence:735
Rv3415c hyp hypothetical protein 732 732 ctx cooccurence:731
Rv0479c membrane protein 730 731 ctx cooccurence:729
Rv1836c hyp hypothetical protein 729 730 ctx cooccurence:727

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv2743c PF25587.2 (E=2e-81)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217259.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv2743c (PF25587.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2FK8T
  • Curated reference: UniProt I6YA50 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 107 functional partner(s); context anchor lppL
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002920|Rv2743c|
MAVKAGQRRPWRSLLQRGVDTAGDLADLVAQKISVAIDPRARLLRRRRRALRWGLVFTAGCLLWGLVTALLAAWGWFTSLLVITGTIAVTQAIPATLLLLRYRWLRSEPLPVRRPASVRRLPPPGSAARPAMSALGASERGFFSLLGVMERGAMLPADEIRDLTAAANQTSAAMVATAAEVVSMERAVQCSAASRSYLVPTINAFTAQLSTGVRQYNEMVTAAAQLVSSANGAGGAGPGQQRYREELAGATDRLVAWAQAFDELGGLPRR