lppL Family assigned · medium

H37Rv Rv2138 · MTBC0 mtbc0_002271 · 358 aa · 2424593–2425669 (+) · RefSeq NP_216654.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LppL
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)PkwA-like protein (WD40-repeat / Ser-Thr-kinase-associated fold). RefSeq leaves it 'hypothetical protein'.

Curated reference (UniProt)

UniProt O06237 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved lipoprotein LppL

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelppL
eggNOG descriptionamine dehydrogenase activity
Orthologous groupCOG3391

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.285 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0556 (transmembrane protein), high confidence from genomic context alone (score 771 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3212 hyp hypothetical protein 792 782 ctx cooccurence:769
Rv0556 transmembrane protein 771 771 ctx cooccurence:770
Rv1081c membrane protein 768 769 ctx cooccurence:767
Rv0996 transmembrane protein 883 767 ctx cooccurence:766 textmining:519
Rv2743c hyp hypothetical protein 765 765 ctx cooccurence:765
Rv0431 tuberculin-like peptide 759 759 ctx cooccurence:758
Rv1109c hyp hypothetical protein 752 752 ctx cooccurence:750
Rv0513 transmembrane protein 749 749 ctx cooccurence:743
Rv2360c hyp hypothetical protein 741 742 ctx cooccurence:740
Rv0383c ttfA hyp hypothetical protein 748 739 ctx cooccurence:738
Rv2091c membrane protein 739 739 ctx cooccurence:738
Rv0817c lmeA hyp hypothetical protein 738 739 ctx cooccurence:737
Rv2732c transmembrane protein 737 738 ctx cooccurence:737
Rv3004 cfp6 low molecular weight protein antigen 6 736 736 ctx cooccurence:736
Rv1632c hyp hypothetical protein 735 736 ctx cooccurence:734

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: Ser/Thr kinase PkwA, TM 0.66, E 7e-12
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216654.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3391
  • Curated reference: UniProt O06237 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 141 functional partner(s); context anchor Rv0556
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002271|Rv2138|lppL
MLTGNKPAVQRRFIGLLMLSVLVAGCSSNPLANFAPGYPPTIEPAQPAVSPPTSQDPAGAVRPLSGHPRAALFDNGTRQLVALRPGADSAAPASIMVFDDVHVAPRVIFLPGPAAALTSDDHGTAFLAARGGYFVADLSSGHTARVNVADAAHTDFTAIARRSDGKLVLGSADGAVYTLAKNPAVDPASGAATVASRTKIFARVDALVTQGNTTVVLDRGQTSVTTIGADGHAQQALRAGQGATTMAADPLGRVLIADTRGGQLLVYGVDPLILRQAYPVRQAPYGLAGSRELAWVSQTASNTVIGYDLTTGIPVEKVRYPTVQQPNSLAFDETSDTLYVVSGSGAGVQVIEHAAGTR