Rv2360c Still unknown · low
H37Rv Rv2360c · MTBC0 mtbc0_002512 ·
142 aa · 2666343–2666771 (-) ·
RefSeq NP_216876.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical; function unknown. Structure-based hint rejected: non-transferable fold (Deinococcus DR_1245 chaperone); function unknown. |
Curated reference (UniProt)
| UniProt |
O05838
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein |
UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2CA90 |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.092 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 82.8 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
4h5b-assembly1_A |
0.99 | 0.52 | 1.6e-02 | 4h5b-assembly1_A Crystal Structure of DR_1245 from Deinococcus radiodurans |
3ule-assembly1_D |
0.23 | 0.26 | 1.0e-01 | 3ule-assembly1_D Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP |
4usi-assembly1_A |
0.21 | 0.34 | 3.2e-01 | 4usi-assembly1_A Nitrogen regulatory protein PII from Chlamydomonas reinhardtii in complex with MgATP and 2-oxoglutarate |
1fr5-assembly1_A |
0.21 | 0.34 | 3.5e-01 | 1fr5-assembly1_A PHAGE FR CAPSIDS WITH A FOUR RESIDUE DELETION IN THE COAT PROTEIN FG LOOP |
6dec-assembly1_D |
0.21 | 0.29 | 2.4e-01 | 6dec-assembly1_D Crystal structure of Bos taurus Arp2/3 complex binding with C-terminus of Homo sapiens SPIN90 |
6yw7-assembly1_D |
0.16 | 0.23 | 1.6e-01 | 6yw7-assembly1_D Cryo-EM structure of the ARP2/3 1A5C isoform complex. |
1hwu-assembly3_B |
0.14 | 0.39 | 1.1e+00 | 1hwu-assembly3_B STRUCTURE OF PII PROTEIN FROM HERBASPIRILLUM SEROPEDICAE |
6ser-assembly1_A |
0.12 | 0.29 | 3.0e-01 | 6ser-assembly1_A Crystal structure of human STARD10 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: uppS (decaprenyl diphosphate synthase), high confidence from genomic context alone (score 904 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2361c uppS |
decaprenyl diphosphate synthase | 937 | 904 ctx | neighborhood:882 |
Rv2362c recO |
DNA repair protein RecO | 902 | 887 ctx | neighborhood:882 |
Rv2363 amiA2 |
amidase | 786 | 786 ctx | neighborhood:786 |
Rv0556 |
transmembrane protein | 768 | 768 ctx | cooccurence:761 |
Rv3212 hyp |
hypothetical protein | 767 | 767 ctx | cooccurence:764 |
Rv0497 |
transmembrane protein | 766 | 767 ctx | cooccurence:766 |
Rv2732c |
transmembrane protein | 762 | 762 ctx | cooccurence:761 |
Rv1486c hyp |
hypothetical protein | 760 | 760 ctx | cooccurence:758 |
Rv1109c hyp |
hypothetical protein | 758 | 758 ctx | cooccurence:757 |
Rv0383c ttfA hyp |
hypothetical protein | 752 | 752 ctx | cooccurence:752 |
Rv0863 hyp |
hypothetical protein | 750 | 751 ctx | cooccurence:749 |
Rv0475 hbhA |
heparin binding hemagglutinin HbhA | 750 | 750 ctx | cooccurence:750 |
Rv2138 lppL |
lipoprotein LppL | 741 | 742 ctx | cooccurence:740 |
Rv0775 hyp |
hypothetical protein | 737 | 737 ctx | cooccurence:734 |
Rv2091c |
membrane protein | 735 | 735 ctx | cooccurence:734 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Structural Foldseek hit not propagated -- non-transferable fold (Deinococcus DR_1245 chaperone); function unknown
- Reviewed against literature (extended structural cross-check, 2026-06-02)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216876.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2CA90 - Curated reference: UniProt O05838 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 82.8, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
95 functional partner(s); context anchor
uppS - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002512|Rv2360c| MPSLPDRLASILRDVLPAEEEPDGALTVRHDGTFASLRVVSIAEDLELVSLTQILAWDLPLTKRLTEQVAKQARDINFGSVSLREKVSEKAARRSSGRPASNTADVMLRYNFPGTGLTDDALRTLILLVLETGATIRSALVG