modA Family assigned · medium auto-curated

H37Rv Rv1857 · MTBC0 mtbc0_001970 · 261 aa · 2123023–2123808 (+) · RefSeq NP_216373.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdate ABC transporter substrate-binding lipoprotein ModA
MTBC0 PGAP re-annotationmolybdate ABC transporter substrate-binding protein
Revised (this work)Molybdate ABC transporter substrate-binding protein. Pfam: SBP_bac_11 (PF13531.12), SBP_bac_1 (PF01547.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGU3 SwissProt · reviewed · Evidence at protein level
UniProt nameMolybdate-binding protein ModA
Curated functionInvolved in the transport of molybdenum into the cell. Part of the binding-protein-dependent transport system ModABCD (By similarity).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred namemodA
eggNOG descriptionABC transporter, periplasmic molybdate-binding protein
Orthologous groupCOG0725
KEGG orthology K02020
KEGG pathways map02010
KEGG modules M00189
Gene Ontology (21) GO:0003674, GO:0005488, GO:0005575, GO:0005623, GO:0008150, GO:0030288, GO:0030313, GO:0030973, GO:0031975, GO:0040007, GO:0042597, GO:0043167 +9 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.369 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SBP_bac_11PF13531.12 7.2e-4841–258 Bacterial extracellular solute-binding protein
SBP_bac_1PF01547.31 7.8e-2646–249 Bacterial extracellular solute-binding protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: modB (molybdenum ABC transporter permease ModB), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1858 modB molybdenum ABC transporter permease ModB 999 999 ctx neighborhood:816 cooccurence:772 coexpression:886 database:800 textmining:902
Rv1859 modC molybdenum ABC transporter ATP-binding protein ModC 987 984 ctx neighborhood:882 database:800
Rv2399c cysT sulfate ABC transporter permease CysT 969 964 ctx cooccurence:623 experimental:895
Rv1860 apa hyp hypothetical protein 682 652 ctx neighborhood:652
Rv2398c cysW sulfate ABC transporter permease CysW 769 627 ctx cooccurence:617 textmining:408
Rv1856c oxidoreductase 582 579 ctx neighborhood:573
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 746 544 ctx cooccurence:424 textmining:468
Rv1855c oxidoreductase 507 508 ctx neighborhood:507
Rv3859c gltB glutamate synthase large subunit 539 474 coexpression:403
Rv0865 mog molybdopterin biosynthesis protein 588 435
Rv2920c amt ammonium transporter integral membrane protein 480 420 coexpression:417
Rv2397c cysA1 sulfate ABC transporter ATP-binding protein CysA 552 382
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 553 381
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 646 368 textmining:464
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 489 345

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: molybdate ABC transporter substrate-binding lipoprotein ModA
  • MTBC0 PGAP product: molybdate ABC transporter substrate-binding protein
  • Pfam (hmmscan --cut_ga): SBP_bac_11 PF13531.12 (E=7e-48), SBP_bac_1 PF01547.31 (E=8e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216373.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SBP_bac_11 (PF13531.12), SBP_bac_1 (PF01547.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0725
  • Curated reference: UniProt P9WGU3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 38 functional partner(s); context anchor modB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001970|Rv1857|modA
MRWIGLSTGLVSAMLVAGLVACGSNSPASSPAGPTQGARSIVVFAAASLQSAFTQIGEQFKAGNPGVNVNFAFAGSSELATQLTQGATADVFASADTAQMDSVAKAGLLAGHPTNFATNTMVIVAAAGNPKKIRSFADLTRPGLNVVVCQPSVPCGSATRRIEDATGIHLNPVSEELSVTDVLNKVITGQADAGLVYVSDALSVATKVTCVRFPEAAGVVNVYAIAVLKRTSQPALARQFVAMVTAAAGRRILDQSGFAKP