moaD2 Family assigned · medium auto-curated

H37Rv Rv0868c · MTBC0 mtbc0_000923 · 92 aa · 969186–969464 (-) · RefSeq NP_215383.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclic pyranopterin monophosphate synthase
MTBC0 PGAP re-annotationmolybdopterin synthase subunit MoaD2
Revised (this work)Molybdopterin synthase subunit MoaD2. Pfam: ThiS (PF02597.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6XWG2 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMolybdopterin synthase sulfur carrier subunit

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaD2
eggNOG descriptionMolybdopterin converting factor, small subunit
Orthologous groupCOG1977
KEGG orthology K03636
KEGG pathways map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.404 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ThiSPF02597.27 8.2e-1315–92 ThiS family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaA2 (molybdenum cofactor biosynthesis protein MoaA), high confidence from genomic context alone (score 962 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 999 1000 coexpression:494 experimental:999 database:900 textmining:663
Rv3323c moaX MoaD-MoaE fusion protein MoaX 997 993 coexpression:498 experimental:868 database:900 textmining:600
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 997 993 coexpression:491 experimental:868 database:900 textmining:597
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 970 962 ctx neighborhood:882 coexpression:404 database:500
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 984 955 experimental:415 database:900 textmining:670
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 994 954 experimental:415 database:900 textmining:885
Rv1335 cysO sulfur carrier protein CysO 949 901 database:900 textmining:511
Rv3112 moaD1 molybdenum cofactor biosynthesis protein MoaD 979 900 database:900 textmining:803
Rv0870c integral membrane protein 887 887 ctx neighborhood:882
Rv0865 mog molybdopterin biosynthesis protein 814 799 coexpression:407 database:500
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 880 792 coexpression:504 database:500 textmining:448
Rv0871 cspB cold shock-like protein CspB 768 769 ctx neighborhood:768
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 912 761 coexpression:507 database:500 textmining:649
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 813 760 coexpression:505 database:500
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 872 714 database:500 textmining:571

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase
  • MTBC0 PGAP product: molybdopterin synthase subunit MoaD2
  • Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=8e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215383.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1977
  • Curated reference: UniProt I6XWG2 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor moaA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000923|Rv0868c|moaD2
MTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG