moaD2 Family assigned · medium auto-curated
H37Rv Rv0868c · MTBC0 mtbc0_000923 ·
92 aa · 969186–969464 (-) ·
RefSeq NP_215383.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cyclic pyranopterin monophosphate synthase |
|---|---|
| MTBC0 PGAP re-annotation | molybdopterin synthase subunit MoaD2 |
| Revised (this work) | Molybdopterin synthase subunit MoaD2. Pfam: ThiS (PF02597.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6XWG2
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Molybdopterin synthase sulfur carrier subunit |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaD2 |
| eggNOG description | Molybdopterin converting factor, small subunit |
| Orthologous group | COG1977 |
| KEGG orthology |
K03636
|
| KEGG pathways |
map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.404 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ThiS | PF02597.27 | 8.2e-13 | 15–92 | ThiS family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moaA2 (molybdenum cofactor biosynthesis protein MoaA), high confidence from genomic context alone (score 962 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 999 | 1000 | coexpression:494 experimental:999 database:900 textmining:663 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 997 | 993 | coexpression:498 experimental:868 database:900 textmining:600 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 997 | 993 | coexpression:491 experimental:868 database:900 textmining:597 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 970 | 962 ctx | neighborhood:882 coexpression:404 database:500 |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 984 | 955 | experimental:415 database:900 textmining:670 |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 994 | 954 | experimental:415 database:900 textmining:885 |
Rv1335 cysO |
sulfur carrier protein CysO | 949 | 901 | database:900 textmining:511 |
Rv3112 moaD1 |
molybdenum cofactor biosynthesis protein MoaD | 979 | 900 | database:900 textmining:803 |
Rv0870c |
integral membrane protein | 887 | 887 ctx | neighborhood:882 |
Rv0865 mog |
molybdopterin biosynthesis protein | 814 | 799 | coexpression:407 database:500 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 880 | 792 | coexpression:504 database:500 textmining:448 |
Rv0871 cspB |
cold shock-like protein CspB | 768 | 769 ctx | neighborhood:768 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 912 | 761 | coexpression:507 database:500 textmining:649 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 813 | 760 | coexpression:505 database:500 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 872 | 714 | database:500 textmining:571 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cyclic pyranopterin monophosphate synthase
- MTBC0 PGAP product: molybdopterin synthase subunit MoaD2
- Pfam (hmmscan --cut_ga): ThiS PF02597.27 (E=8e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215383.1)
- Domains: Pfam-A via hmmscan --cut_ga — ThiS (PF02597.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1977 - Curated reference: UniProt I6XWG2 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
moaA2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000923|Rv0868c|moaD2 MTQVSDESAGIQVTVRYFAAARAAAGAGSEKVTLRSGATVAELIDGLSVRDVRLATVLSRCSYLRDGIVVRDDAVALSAGDTIDVLPPFAGG