mog Family assigned · medium auto-curated

H37Rv Rv0865 · MTBC0 mtbc0_000920 · 160 aa · 966593–967075 (+) · RefSeq NP_215380.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdopterin biosynthesis protein
MTBC0 PGAP re-annotationMogA/MoaB family molybdenum cofactor biosynthesis protein
Revised (this work)MogA/MoaB family molybdenum cofactor biosynthesis protein. Pfam: MoCF_biosynth (PF00994.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y8Y8 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable molybdopterin biosynthesis Mog protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemog
eggNOG descriptionMolybdenum cofactor synthesis
Orthologous groupCOG0521
EC number EC 2.8.1.12
KEGG orthology K03635
KEGG pathways map00790, map01100, map04122

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoCF_biosynthPF00994.30 9.5e-248–147 Probable molybdopterin binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaC2 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 999 998 ctx neighborhood:882 fusion:843 cooccurence:730 coexpression:666 textmining:799
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 999 997 ctx neighborhood:882 fusion:900 coexpression:466 database:500 textmining:926
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 984 981 ctx fusion:883 cooccurence:712 coexpression:439
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 983 980 ctx fusion:860 cooccurence:705 coexpression:439
Rv0438c moeA2 molybdopterin molybdenumtransferase 960 949 ctx fusion:442 cooccurence:736 database:500
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 916 891 ctx cooccurence:674 database:500
Rv0863 hyp hypothetical protein 879 879 ctx neighborhood:876
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 982 851 ctx cooccurence:756 textmining:885
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 814 799 coexpression:407 database:500
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 907 794 ctx cooccurence:708 textmining:567
Rv0862c hyp hypothetical protein 790 790 ctx neighborhood:789
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 822 768 coexpression:412 database:500
Rv3323c moaX MoaD-MoaE fusion protein MoaX 818 757 coexpression:685
Rv0861c ercc3 DNA helicase Ercc3 525 525 ctx neighborhood:521
Rv1161 narG nitrate reductase subunit alpha 535 470

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: molybdopterin biosynthesis protein
  • MTBC0 PGAP product: MogA/MoaB family molybdenum cofactor biosynthesis protein
  • Pfam (hmmscan --cut_ga): MoCF_biosynth PF00994.30 (E=1e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215380.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoCF_biosynth (PF00994.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0521
  • Curated reference: UniProt I6Y8Y8 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 35 functional partner(s); context anchor moaC2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000920|Rv0865|mog
MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR