mog Family assigned · medium auto-curated
H37Rv Rv0865 · MTBC0 mtbc0_000920 ·
160 aa · 966593–967075 (+) ·
RefSeq NP_215380.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | molybdopterin biosynthesis protein |
|---|---|
| MTBC0 PGAP re-annotation | MogA/MoaB family molybdenum cofactor biosynthesis protein |
| Revised (this work) | MogA/MoaB family molybdenum cofactor biosynthesis protein. Pfam: MoCF_biosynth (PF00994.30). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
I6Y8Y8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable molybdopterin biosynthesis Mog protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | mog |
| eggNOG description | Molybdenum cofactor synthesis |
| Orthologous group | COG0521 |
| EC number |
EC 2.8.1.12
|
| KEGG orthology |
K03635
|
| KEGG pathways |
map00790, map01100, map04122
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoCF_biosynth | PF00994.30 | 9.5e-24 | 8–147 | Probable molybdopterin binding domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: moaC2 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 998 ctx | neighborhood:882 fusion:843 cooccurence:730 coexpression:666 textmining:799 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 999 | 997 ctx | neighborhood:882 fusion:900 coexpression:466 database:500 textmining:926 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 984 | 981 ctx | fusion:883 cooccurence:712 coexpression:439 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 983 | 980 ctx | fusion:860 cooccurence:705 coexpression:439 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 960 | 949 ctx | fusion:442 cooccurence:736 database:500 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 916 | 891 ctx | cooccurence:674 database:500 |
Rv0863 hyp |
hypothetical protein | 879 | 879 ctx | neighborhood:876 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 982 | 851 ctx | cooccurence:756 textmining:885 |
Rv0868c moaD2 |
cyclic pyranopterin monophosphate synthase | 814 | 799 | coexpression:407 database:500 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 907 | 794 ctx | cooccurence:708 textmining:567 |
Rv0862c hyp |
hypothetical protein | 790 | 790 ctx | neighborhood:789 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 822 | 768 | coexpression:412 database:500 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 818 | 757 | coexpression:685 |
Rv0861c ercc3 |
DNA helicase Ercc3 | 525 | 525 ctx | neighborhood:521 |
Rv1161 narG |
nitrate reductase subunit alpha | 535 | 470 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: molybdopterin biosynthesis protein
- MTBC0 PGAP product: MogA/MoaB family molybdenum cofactor biosynthesis protein
- Pfam (hmmscan --cut_ga): MoCF_biosynth PF00994.30 (E=1e-23)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215380.1)
- Domains: Pfam-A via hmmscan --cut_ga — MoCF_biosynth (PF00994.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0521 - Curated reference: UniProt I6Y8Y8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
35 functional partner(s); context anchor
moaC2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000920|Rv0865|mog MSTRSARIVVVSSRAAAGVYTDDCGPIIAGWLEQHGFSSVQPQVVADGNPVGEALHDAVNAGVDVIITSGGTGISPTDTTPEHTVAVLDYVIPGLADAIRRSGLPKVPTSVLSRGVCGVAGRTLIINLPGSPGGVRDGLGVLADVLDHALEQIAGGDHPR