moaA2 Resolved · high auto-curated

H37Rv Rv0869c · MTBC0 mtbc0_000924 · 360 aa · 969468–970550 (-) · RefSeq NP_215384.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)molybdenum cofactor biosynthesis protein MoaA
MTBC0 PGAP re-annotationGTP 3'%2C8-cyclase MoaA
Revised (this work)GTP 3'%2C8-cyclase MoaA. Pfam: Radical_SAM (PF04055.28), Mob_synth_C (PF06463.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WJS1 SwissProt · reviewed · Evidence at protein level
UniProt nameGTP 3',8-cyclase 2
EC (curated) EC 4.1.99.22
Curated functionCatalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaA
eggNOG descriptionCatalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate
Orthologous groupCOG2896
EC number EC 4.1.99.22
KEGG orthology K03639
KEGG pathways map00790, map01100, map04122
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.285 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Radical_SAMPF04055.28 2.1e-3143–206 Radical SAM superfamily
Mob_synth_CPF06463.19 8.6e-35211–342 Molybdenum Cofactor Synthesis C

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaC2 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 999 999 ctx fusion:900 cooccurence:773 coexpression:647 database:900 textmining:929
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 999 999 ctx fusion:899 cooccurence:773 coexpression:645 database:900 textmining:483
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 999 999 ctx fusion:900 cooccurence:773 coexpression:645 database:900 textmining:738
Rv0868c moaD2 cyclic pyranopterin monophosphate synthase 970 962 ctx neighborhood:882 coexpression:404 database:500
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 933 918 database:900
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 995 907 ctx cooccurence:641 coexpression:408 database:500 textmining:949
Rv3609c folE GTP cyclohydrolase I 906 907 database:900
Rv1415 ribA2 bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase 907 904 database:900
Rv1940 ribA1 riboflavin biosynthesis protein RibA 906 903 database:900
Rv0870c integral membrane protein 883 883 ctx neighborhood:882
Rv0438c moeA2 molybdopterin molybdenumtransferase 903 864 ctx cooccurence:767
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 870 862 ctx cooccurence:559 coexpression:402 database:500
Rv3323c moaX MoaD-MoaE fusion protein MoaX 889 852 ctx cooccurence:547 coexpression:646
Rv0865 mog molybdopterin biosynthesis protein 982 851 ctx cooccurence:756 textmining:885
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 849 830 ctx cooccurence:745

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: molybdenum cofactor biosynthesis protein MoaA
  • MTBC0 PGAP product: GTP 3'%2C8-cyclase MoaA
  • Pfam (hmmscan --cut_ga): Radical_SAM PF04055.28 (E=2e-31), Mob_synth_C PF06463.19 (E=9e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215384.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Radical_SAM (PF04055.28), Mob_synth_C (PF06463.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2896
  • Curated reference: UniProt P9WJS1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 41 functional partner(s); context anchor moaC2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000924|Rv0869c|moaA2
MTLTALGMPALRSRTNGIADPRVVPTTGPLVDTFGRVANDLRVSLTDRCNLRCSYCMPERGLRWLPGEQLLRPDELARLIHIAVTRLGVTSVRFTGGEPLLAHHLDEVVAATARLRPRPEISLTTNGVGLARRAGALAEAGLDRVNVSLDSIDRAHFAAITRRDRLAHVLAGLAAAKAAGLTPVKVNAVLDPTTGREDVVDLLRFCLERGYQLRVIEQMPLDAGHSWRRNIALSADDVLAALRPHFRLRPDPAPRGSAPAELWLVDAGPNTPRGRFGVIASVSHAFCSTCDRTRLTADGQIRSCLFSTEETDLRRLLRGGADDDAIEAAWRAAMWSKPAGHGINAPDFIQPDRPMSAIGG