moaA2 Resolved · high auto-curated
H37Rv Rv0869c · MTBC0 mtbc0_000924 ·
360 aa ·
969468–970550 MTBC0
(-) ·
RefSeq NP_215384.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | molybdenum cofactor biosynthesis protein MoaA |
|---|---|
| MTBC0 PGAP re-annotation | GTP 3'%2C8-cyclase MoaA |
| Revised (this work) | GTP 3'%2C8-cyclase MoaA. Pfam: Radical_SAM (PF04055.28), Mob_synth_C (PF06463.19). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) never studied
No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | yccF (Rv0870c, - strand) |
|---|---|
| Overlap | 4 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.97 (95% CI -1.37 to 4.26). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in molybdenum cofactor biosynthesis; involved in the biosynthesis of molybdopterin precursor Z from guanosine. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0893c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_4663
· 82.2% identity |
| M. smegmatis |
MSMEG_5698
· 73.4% identity |
| M. orygis |
RJtmp_000919
· 100.0% identity |
| M. abscessus |
MAB_0871c
· 66.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJS1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | GTP 3',8-cyclase 2 |
| EC (curated) |
EC 4.1.99.22
|
| Curated function | Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaA |
| eggNOG description | Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate |
| Orthologous group | COG2896 |
| EC number |
EC 4.1.99.22
|
| KEGG orthology |
K03639
|
| KEGG pathways |
map00790, map01100, map04122
|
| Gene Ontology (6) |
GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 2.285 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 51/53 (96%) · mean identity 80.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 53.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 151.428571429. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 9 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 2.47 ppm · rank 3129/3519 (11.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 360 aa |
|---|---|
| Molecular weight | 39.0 kDa |
| Theoretical pI | 9.19 |
| GRAVY | -0.111 (hydrophilic) |
| Aliphatic index | 95.2 |
| Aromaticity | 0.044 |
| Instability index | 44.4 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Radical_SAM | PF04055.28 | 2.1e-31 | 43–206 | Radical SAM superfamily |
Mob_synth_C | PF06463.19 | 8.6e-35 | 211–342 | Molybdenum Cofactor Synthesis C |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2fb2-assembly1_B |
1.00 | 0.89 | 3.5e-28 sig | 2fb2-assembly1_B Structure of the MoaA Arg17/266/268/Ala triple mutant |
1tv7-assembly1_B |
1.00 | 0.88 | 3.2e-27 sig | 1tv7-assembly1_B Structure of the S-adenosylmethionine dependent Enzyme MoaA |
7tom-assembly1_A |
1.00 | 0.74 | 1.1e-10 sig | 7tom-assembly1_A X-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (GDGT-MAS) from Methanocaldococcus jannaschii with bacterial lipid substrate analog, 5'deoxyadenosine, and methionine bound |
7tol-assembly1_A |
1.00 | 0.75 | 1.9e-10 sig | 7tol-assembly1_A X-ray crystal structure of glycerol dibiphytanyl glycerol tetraether - macrocyclic archaeol synthase (GDGT-MAS) from Methanocaldococcus jannaschii with archaeal lipid, 5'deoxyadenosine, and methionine bound |
7voc-assembly1_C |
1.00 | 0.53 | 1.3e-12 sig | 7voc-assembly1_C The crystal structure of a Radical SAM Enzyme BlsE involved in the Biosynthesis of Blasticidin S |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | moaD2 (- strand, 3 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0870c (- strand, -4 bp gap) |
| Predicted operon |
moaD2 · moaA2 · Rv0870c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: moaC2 (cyclic pyranopterin monophosphate synthase accessory protein), high confidence from genomic context alone (score 999 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0864 moaC2 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 999 ctx | fusion:900 cooccurence:773 coexpression:647 database:900 textmining:929 |
Rv3324c moaC3 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 999 ctx | fusion:899 cooccurence:773 coexpression:645 database:900 textmining:483 |
Rv3111 moaC1 exp |
cyclic pyranopterin monophosphate synthase accessory protein | 999 | 999 ctx | fusion:900 cooccurence:773 coexpression:645 database:900 textmining:738 |
Rv0868c moaD2 exp |
cyclic pyranopterin monophosphate synthase | 970 | 962 ctx | neighborhood:882 coexpression:404 database:500 |
Rv3109 moaA1 exp |
cyclic pyranopterin monophosphate synthase | 933 | 918 | database:900 |
Rv0866 moaE2 exp |
molybdopterin synthase catalytic subunit 2 | 995 | 907 ctx | cooccurence:641 coexpression:408 database:500 textmining:949 |
Rv3609c folE exp |
GTP cyclohydrolase I | 906 | 907 | database:900 |
Rv1415 ribA2 exp |
bifunctional riboflavin biosynthesis GTP cyclohydrolase II/3,4-dihydroxy-2-butanone 4-phosphate synthase | 907 | 904 | database:900 |
Rv1940 ribA1 exp |
riboflavin biosynthesis protein RibA | 906 | 903 | database:900 |
Rv0870c |
integral membrane protein | 883 | 883 ctx | neighborhood:882 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 903 | 864 ctx | cooccurence:767 |
Rv3119 moaE1 exp |
molybdopterin synthase catalytic subunit 1 | 870 | 862 ctx | cooccurence:559 coexpression:402 database:500 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 889 | 852 ctx | cooccurence:547 coexpression:646 |
Rv0865 mog |
molybdopterin biosynthesis protein | 982 | 851 ctx | cooccurence:756 textmining:885 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 849 | 830 ctx | cooccurence:745 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: molybdenum cofactor biosynthesis protein MoaA
- MTBC0 PGAP product: GTP 3'%2C8-cyclase MoaA
- Pfam (hmmscan --cut_ga): Radical_SAM PF04055.28 (E=2e-31), Mob_synth_C PF06463.19 (E=9e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215384.1)
- Domains: Pfam-A via hmmscan --cut_ga — Radical_SAM (PF04055.28), Mob_synth_C (PF06463.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2896 - Curated reference: UniProt P9WJS1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
41 functional partner(s); context anchor
moaC2 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000924|Rv0869c|moaA2 MTLTALGMPALRSRTNGIADPRVVPTTGPLVDTFGRVANDLRVSLTDRCNLRCSYCMPERGLRWLPGEQLLRPDELARLIHIAVTRLGVTSVRFTGGEPLLAHHLDEVVAATARLRPRPEISLTTNGVGLARRAGALAEAGLDRVNVSLDSIDRAHFAAITRRDRLAHVLAGLAAAKAAGLTPVKVNAVLDPTTGREDVVDLLRFCLERGYQLRVIEQMPLDAGHSWRRNIALSADDVLAALRPHFRLRPDPAPRGSAPAELWLVDAGPNTPRGRFGVIASVSHAFCSTCDRTRLTADGQIRSCLFSTEETDLRRLLRGGADDDAIEAAWRAAMWSKPAGHGINAPDFIQPDRPMSAIGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for moaA2? Email the maintainer — the message is pre-filled with this gene's details.