ureA Family assigned · medium auto-curated
H37Rv Rv1848 · MTBC0 mtbc0_001961 ·
100 aa ·
2115386–2115688 MTBC0
(+) ·
RefSeq NP_216364.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | urease subunit gamma |
|---|---|
| MTBC0 PGAP re-annotation | urease subunit gamma |
| Revised (this work) | Urease subunit gamma. Pfam: Urease_gamma (PF00547.24). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 391 publications
391 TB publications mention this gene. 391 publication(s) discuss this gene (345 in a M. tuberculosis context, 36 in other mycobacteria — M. smegmatis (25), M. leprae (8), M. abscessus (4), M. marinum (2)).
| Publication | Date |
|---|---|
| Predictors of mortality in hospitalized patients with disseminated histoplasmosis. doi:10.1016/j.bjid.2026.105891 | 2026 |
| Comparative analysis of clinical manifestations between congenital and non-congenital tuberculosis in infants. doi:10.1186/s12879-026-13484-3 | 2026 |
| Mycobacterium avium complex in captive swamp wallabies (Wallabia bicolor): a case series highlighting liver, lymphoid and bone predilection. doi:10.1016/j.jcpa.2026.03.005 | 2026 |
| Clinical profile and predictors of mortality among people living with HIV/AIDS with Mycobacterium tuberculosis detected in blood or bone marrow at a tertiary hospital in Northeast Brazil. doi:10.1177/00494755261435265 | 2026 |
| Proof-of-concept bioelectrochemical characterization of Mycolicibacterium smegmatis for diagnostic applications. doi:10.1016/j.bioelechem.2026.109277 | 2026 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | ureB (Rv1849, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.81 (95% CI -0.78 to 3.34). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the conversion of urea to NH3 [catalytic activity: urea + H2O = CO2 + 2 NH3] |
|---|---|
| Mycobrowser EC |
3.5.1.5
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1879
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2722
· 89.9% identity |
| M. smegmatis |
MSMEG_3627
· 89.0% identity |
| M. orygis |
RJtmp_001916
· 100.0% identity |
| M. abscessus |
MAB_2423
· 87.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFE7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Urease subunit gamma |
| EC (curated) |
EC 3.5.1.5
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | ureA |
| eggNOG description | Belongs to the urease gamma subunit family |
| Orthologous group | COG0831 |
| EC number |
EC 3.5.1.5
|
| KEGG orthology |
K01430
|
| KEGG pathways |
map00220, map00230, map00791, map01100, map01120
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.343 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
inf (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 32/53 (60%) · mean identity 88.7%
· 3/4 closest MTBAP relatives conserved across the genus (present in 32/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 75.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 2 in the ORF — 0 in the essential state, 0 growth-defect, 2 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 191. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 2 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -7.29 | 0.031 | required |
| fitness in mouse infection (in vivo) | -5.41 | 0.023 | required |
| fitness in mouse infection (in vivo) | -2.31 | 0.034 | required |
| fitness in mouse infection (in vivo) | -1.94 | 0.021 | required |
| fitness in mouse infection (in vivo) | +1.35 | 0.05 | disruption advantageous |
| fitness in mouse infection (in vivo) | -1.20 | 0.033 | required |
Conditional fitness of transposon-disruption mutants across 6 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 86.8 ppm · rank 1402/3519 (60.2th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 100 aa |
|---|---|
| Molecular weight | 11.1 kDa |
| Theoretical pI | 5.78 |
| GRAVY | -0.227 (hydrophilic) |
| Aliphatic index | 101.5 |
| Aromaticity | 0.02 |
| Instability index | 45.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Urease_gamma | PF00547.24 | 1.2e-47 | 1–99 | Urease, gamma subunit |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2fvh |
X-ray diffraction | 1.8 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2fvh-assembly1_C |
1.00 | 0.98 | 8.3e-18 sig | 2fvh-assembly1_C Crystal Structure of Rv1848, a Urease Gamma Subunit UreA (Urea amidohydrolase), from Mycobacterium Tuberculosis |
1s3t-assembly1_A |
1.00 | 0.97 | 2.9e-14 sig | 1s3t-assembly1_A BORATE INHIBITED BACILLUS PASTEURII UREASE CRYSTAL STRUCTURE |
8a18-assembly1_AAA |
1.00 | 0.97 | 5.1e-14 sig | 8a18-assembly1_AAA 1.63 A resolution hydroquinone inhibited Sporosarcina pasteurii urease |
1a5k-assembly1_A |
1.00 | 0.96 | 7.5e-14 sig | 1a5k-assembly1_A K217E VARIANT OF KLEBSIELLA AEROGENES UREASE |
4fur-assembly1_A |
1.00 | 0.97 | 1.9e-13 sig | 4fur-assembly1_A Crystal Structure of Urease subunit gamma 2 from Brucella melitensis biovar Abortus 2308 |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 7
| Upstream (5' on genome) | Rv1847 (+ strand, 48 bp gap) |
|---|---|
| Downstream (3' on genome) | ureB (+ strand, -4 bp gap) |
| Predicted operon |
Rv1847 · ureA · ureB · ureC · ureF · ureG · ureD
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
Rv0302 (activates) · Rv0767c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: ureB (urease subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1849 ureB exp |
urease subunit beta | 999 | 1000 ctx | neighborhood:882 fusion:899 cooccurence:774 coexpression:880 experimental:927 database:900 textmining:845 |
Rv1850 ureC exp |
urease subunit alpha | 999 | 1000 ctx | neighborhood:882 fusion:900 cooccurence:774 coexpression:860 experimental:928 database:900 |
Rv1852 ureG |
urease accessory protein UreG | 993 | 991 ctx | neighborhood:874 cooccurence:774 coexpression:716 |
Rv1851 ureF |
urease accessory protein UreF | 985 | 982 ctx | neighborhood:882 coexpression:785 |
Rv1853 ureD |
urease accessory protein UreD | 973 | 967 ctx | neighborhood:874 coexpression:709 |
Rv1847 |
esterase | 806 | 806 ctx | neighborhood:804 |
Rv2678c hemE |
uroporphyrinogen decarboxylase | 519 | 520 | coexpression:504 |
Rv1846c blaI |
transcriptional repressor BlaI | 402 | 402 | |
Rv2747 argA |
L-glutamate alpha-N-acetyltranferase | 662 | 56 | textmining:657 |
Rv1885c |
chorismate mutase | 804 | 47 | textmining:803 |
Rv2883c pyrH |
uridylate kinase | 551 | 47 | textmining:549 |
Rv2537c aroD |
3-dehydroquinate dehydratase | 755 | 44 | textmining:755 |
Rv3859c gltB |
glutamate synthase large subunit | 622 | 42 | textmining:622 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: urease subunit gamma
- MTBC0 PGAP product: urease subunit gamma
- Pfam (hmmscan --cut_ga): Urease_gamma PF00547.24 (E=1e-47)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216364.1)
- Domains: Pfam-A via hmmscan --cut_ga — Urease_gamma (PF00547.24)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0831 - Curated reference: UniProt P9WFE7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
ureB - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001961|Rv1848|ureA MRLTPHEQERLLLSYAAELARRRRARGLRLNHPEAIAVIADHILEGARDGRTVAELMASGREVLGRDDVMEGVPEMLAEVQVEATFPDGTKLVTVHQPIA
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ureA? Email the maintainer — the message is pre-filled with this gene's details.