ureA Family assigned · medium auto-curated

H37Rv Rv1848 · MTBC0 mtbc0_001961 · 100 aa · 2115386–2115688 (+) · RefSeq NP_216364.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)urease subunit gamma
MTBC0 PGAP re-annotationurease subunit gamma
Revised (this work)Urease subunit gamma. Pfam: Urease_gamma (PF00547.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFE7 SwissProt · reviewed · Evidence at protein level
UniProt nameUrease subunit gamma
EC (curated) EC 3.5.1.5

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameureA
eggNOG descriptionBelongs to the urease gamma subunit family
Orthologous groupCOG0831
EC number EC 3.5.1.5
KEGG orthology K01430
KEGG pathways map00220, map00230, map00791, map01100, map01120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.343 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Urease_gammaPF00547.24 1.2e-471–99 Urease, gamma subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ureB (urease subunit beta), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1849 ureB urease subunit beta 999 1000 ctx neighborhood:882 fusion:899 cooccurence:774 coexpression:880 experimental:927 database:900 textmining:845
Rv1850 ureC urease subunit alpha 999 1000 ctx neighborhood:882 fusion:900 cooccurence:774 coexpression:860 experimental:928 database:900
Rv1852 ureG urease accessory protein UreG 993 991 ctx neighborhood:874 cooccurence:774 coexpression:716
Rv1851 ureF urease accessory protein UreF 985 982 ctx neighborhood:882 coexpression:785
Rv1853 ureD urease accessory protein UreD 973 967 ctx neighborhood:874 coexpression:709
Rv1847 esterase 806 806 ctx neighborhood:804
Rv2678c hemE uroporphyrinogen decarboxylase 519 520 coexpression:504
Rv1846c blaI transcriptional repressor BlaI 402 402
Rv2747 argA L-glutamate alpha-N-acetyltranferase 662 56 textmining:657
Rv1885c chorismate mutase 804 47 textmining:803
Rv2883c pyrH uridylate kinase 551 47 textmining:549
Rv2537c aroD 3-dehydroquinate dehydratase 755 44 textmining:755
Rv3859c gltB glutamate synthase large subunit 622 42 textmining:622

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: urease subunit gamma
  • MTBC0 PGAP product: urease subunit gamma
  • Pfam (hmmscan --cut_ga): Urease_gamma PF00547.24 (E=1e-47)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216364.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Urease_gamma (PF00547.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0831
  • Curated reference: UniProt P9WFE7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor ureB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001961|Rv1848|ureA
MRLTPHEQERLLLSYAAELARRRRARGLRLNHPEAIAVIADHILEGARDGRTVAELMASGREVLGRDDVMEGVPEMLAEVQVEATFPDGTKLVTVHQPIA