adhA Family assigned · medium auto-curated
H37Rv Rv1862 · MTBC0 mtbc0_001975 ·
346 aa ·
2127583–2128623 MTBC0
(+) ·
RefSeq NP_216378.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | alcohol dehydrogenase A |
|---|---|
| MTBC0 PGAP re-annotation | zinc-binding alcohol dehydrogenase family protein |
| Revised (this work) | Zinc-binding alcohol dehydrogenase family protein. Pfam: ADH_N (PF08240.18). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 1 publication
1 TB publication mentions this gene. 1 publication(s) discuss this gene (0 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Roles of horizontal gene transfer and gene integration in evolution of 1,3-dichloropropene- and 1,2-dibromoethane-degradative pathways. doi:10.1128/JB.182.8.2191-2199.2000 | 2000 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
1 reported modified residue(s):
N-acetylvaline @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index 1.29 (95% CI -0.76 to 4.14). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Catalyzes the reversible oxidation of ethanol to acetaldehyde with the concomitant reduction of NAD |
|---|---|
| Mycobrowser EC |
1.1.1.1
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1893
· 100.0% identity |
|---|---|
| M. leprae |
ML2053c
· 84.5% identity |
| M. marinum |
MMAR_2739
· 87.8% identity |
| M. smegmatis |
MSMEG_3615
· 73.0% identity |
| M. orygis |
RJtmp_001930
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WQC1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable alcohol dehydrogenase AdhA |
| EC (curated) |
EC 1.1.1.1
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | adhA |
| eggNOG description | alcohol dehydrogenase |
| Orthologous group | COG1064 |
| EC number |
EC 1.1.1.1
|
| KEGG orthology |
K13953
|
| KEGG pathways |
map00010, map00071, map00350, map00625, map00626, map00830, map00980, map00982, map01100, map01110, map01120, map01130, map01220
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.291 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 84.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 44.2% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 0.933, mean read count 175.714285714. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 35.8 ppm · rank 1980/3519 (43.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 346 aa |
|---|---|
| Molecular weight | 36.6 kDa |
| Theoretical pI | 6.1 |
| GRAVY | 0.023 (hydrophobic) |
| Aliphatic index | 93.4 |
| Aromaticity | 0.058 |
| Instability index | 42.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 1.0e-26 | 38–152 | Alcohol dehydrogenase GroES-like domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3s2e-assembly2_C |
1.00 | 0.91 | 3.8e-35 sig | 3s2e-assembly2_C Crystal Structure of FurX NADH Complex 1 |
6n7l-assembly2_H |
1.00 | 0.92 | 1.2e-34 sig | 6n7l-assembly2_H Crystal structure of an alcohol dehydrogenase from Elizabethkingia anophelis NUHP1 |
3meq-assembly1_C |
1.00 | 0.91 | 3.6e-34 sig | 3meq-assembly1_C Crystal structure of alcohol dehydrogenase from Brucella melitensis |
1rjw-assembly1_D |
1.00 | 0.90 | 3.4e-34 sig | 1rjw-assembly1_D CRYSTAL STRUCTURE OF NAD(+)-DEPENDENT ALCOHOL DEHYDROGENASE FROM BACILLUS STEAROTHERMOPHILUS STRAIN LLD-R |
4z6k-assembly1_D |
1.00 | 0.90 | 6.7e-34 sig | 4z6k-assembly1_D Alcohol dehydrogenase from the antarctic psychrophile Moraxella sp. TAE 123 |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1861 (+ strand, 73 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1863c (- strand, 6 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv1861 (transmembrane protein), high confidence from genomic context alone (score 797 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3293 pcd exp |
piperideine-6-carboxylic acid dehydrogenase | 920 | 915 | database:900 |
Rv0458 exp |
aldehyde dehydrogenase | 919 | 914 | database:900 |
Rv0223c exp |
aldehyde dehydrogenase | 919 | 914 | database:900 |
Rv0147 exp |
aldehyde dehydrogenase | 919 | 914 | database:900 |
Rv0768 aldA exp |
aldehyde dehydrogenase AldA | 918 | 914 | database:900 |
Rv3170 aofH exp |
flavin-containing monoamine oxidase | 904 | 905 | database:900 |
Rv1703c exp |
methyltransferase | 907 | 904 | database:900 |
Rv1833c dhmA2 exp |
haloalkane dehalogenase | 904 | 904 | database:900 |
Rv2296 dhmA1 exp |
haloalkane dehalogenase | 903 | 904 | database:900 |
Rv2579 dhaA exp |
haloalkane dehalogenase | 903 | 904 | database:900 |
Rv3252c alkB exp |
transmembrane alkane 1-monooxygenase AlkB | 924 | 900 | database:900 |
Rv1861 |
transmembrane protein | 796 | 797 ctx | neighborhood:790 |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 760 | 746 ctx | cooccurence:594 |
Rv0853c pdc exp |
alpha-keto-acid decarboxylase | 635 | 586 | database:500 |
Rv1859 modC |
molybdenum ABC transporter ATP-binding protein ModC | 550 | 551 ctx | neighborhood:544 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: alcohol dehydrogenase A
- MTBC0 PGAP product: zinc-binding alcohol dehydrogenase family protein
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-26)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216378.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1064 - Curated reference: UniProt P9WQC1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.2)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
58 functional partner(s); context anchor
Rv1861 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001975|Rv1862|adhA MVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEGDLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSENLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELPPGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPLDAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRADARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for adhA? Email the maintainer — the message is pre-filled with this gene's details.