moaC1 Resolved · high auto-curated

H37Rv Rv3111 · MTBC0 - · 170 aa · 3479171–3479683 (+) · RefSeq YP_177927.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cyclic pyranopterin monophosphate synthase accessory protein
MTBC0 PGAP re-annotation
Revised (this work)Cyclic pyranopterin monophosphate synthase accessory protein. Pfam: MoaC (PF01967.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJR9 SwissProt · reviewed · Evidence at transcript level
UniProt nameCyclic pyranopterin monophosphate synthase 1
EC (curated) EC 4.6.1.17
Curated functionCatalyzes the conversion of (8S)-3',8-cyclo-7,8-dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP) (By similarity). Probably plays a role in host phagosome maturation arrest.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaC
eggNOG descriptionCatalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP)
Orthologous groupCOG0315
EC number EC 4.6.1.17
KEGG orthology K03637
KEGG pathways map00790, map01100, map04122
Gene Ontology (51) GO:0002682, GO:0002683, GO:0005575, GO:0005576, GO:0008150, GO:0009605, GO:0009607, GO:0031347, GO:0031348, GO:0035821, GO:0040007, GO:0043207 +39 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.521 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.14% of strains (201) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoaCPF01967.28 1.7e-5419–153 MoaC family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moaA1 (cyclic pyranopterin monophosphate synthase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 999 1000 ctx neighborhood:634 fusion:592 cooccurence:772 coexpression:948 database:900 textmining:863
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 999 999 ctx fusion:900 cooccurence:773 coexpression:645 database:900 textmining:738
Rv3323c moaX MoaD-MoaE fusion protein MoaX 998 996 ctx cooccurence:466 coexpression:920 database:900 textmining:730
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 996 982 ctx cooccurence:476 coexpression:560 database:900 textmining:825
Rv3112 moaD1 molybdenum cofactor biosynthesis protein MoaD 996 980 ctx neighborhood:736 coexpression:928 textmining:814
Rv0865 mog molybdopterin biosynthesis protein 983 980 ctx fusion:860 cooccurence:705 coexpression:439
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 994 978 ctx cooccurence:408 coexpression:558 database:900 textmining:768
Rv3110 moaB1 pterin-4-alpha-carbinolamine dehydratase 989 972 ctx neighborhood:801 coexpression:863 textmining:652
Rv3113 phosphatase 925 925 ctx neighborhood:489 coexpression:860
Rv3114 hyp hypothetical protein 920 920 ctx neighborhood:453 coexpression:860
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 913 907 database:900
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 905 903 database:900
Rv0438c moeA2 molybdopterin molybdenumtransferase 919 886 ctx cooccurence:762 coexpression:430
Rv0984 moaB2 pterin-4-alpha-carbinolamine dehydratase 915 872 ctx cooccurence:723 coexpression:439
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 871 853 ctx cooccurence:737 coexpression:434

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): cyclic pyranopterin monophosphate synthase accessory protein
  • Pfam (hmmscan --cut_ga): MoaC PF01967.28 (E=2e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177927.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoaC (PF01967.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0315
  • Curated reference: UniProt P9WJR9 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor moaA1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3111|moaC1
MIDHALALTHIDERGAARMVDVSEKPVTLRVAKASGLVIMKPSTLRMISDGAAAKGDVMAAARIAGIAAAKRTGDLIPLCHPLGLDAVSVTITPCEPDRVKILATTTTLGRTGVEMEALTAVSVAALTIYDMCKAVDRAMEISQIVLQEKSGGRSGVYRRSASDLACQSR