Rv1861 Family assigned · medium auto-curated

H37Rv Rv1861 · MTBC0 mtbc0_001974 · 101 aa · 2127203–2127508 (+) · RefSeq NP_216377.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationGlsB/YeaQ/YmgE family stress response membrane protein
Revised (this work)GlsB/YeaQ/YmgE family stress response membrane protein. Pfam: Transgly_assoc (PF04226.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95154 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionTransglycosylase associated protein
Orthologous groupCOG2261

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Transgly_assocPF04226.19 1.6e-1251–100 Transglycosylase associated protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: adhA (alcohol dehydrogenase A), high confidence from genomic context alone (score 797 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1862 adhA alcohol dehydrogenase A 796 797 ctx neighborhood:790
Rv1364c sigma factor regulatory protein 680 662 coexpression:656
Rv3701c egtD histidine-specific methyltransferase EtgD 645 645 coexpression:645
Rv1860 apa hyp hypothetical protein 550 551 ctx neighborhood:544
Rv1859 modC molybdenum ABC transporter ATP-binding protein ModC 546 546 ctx neighborhood:544
Rv1954A Rv1954A, len: 100 aa. Hypothetical unknown protein. 543 517 coexpression:508
Rv1234 transmembrane protein 444 437 coexpression:418
Rv0204c transmembrane protein 455 434 ctx cooccurence:415
Rv1876 bfrA bacterioferritin BfrA 423 423 coexpression:406

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: GlsB/YeaQ/YmgE family stress response membrane protein
  • Pfam (hmmscan --cut_ga): Transgly_assoc PF04226.19 (E=2e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216377.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Transgly_assoc (PF04226.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2261
  • Curated reference: UniProt P95154 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor adhA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001974|Rv1861|
MDITATTEFSAMNLDGKTGIGWLGYIVIGGIAGWLASKIVKGGGSGILMNVVIGVVGAFGAGLVLNALGVDVNHGGYWFTFFVALGGAVVLLWIVGMVRKT