Rv1847 Family assigned · medium auto-curated

H37Rv Rv1847 · MTBC0 mtbc0_001960 · 140 aa · 2114915–2115337 (+) · RefSeq NP_216363.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)esterase
MTBC0 PGAP re-annotationPaaI family thioesterase
Revised (this work)PaaI family thioesterase. Pfam: DUF4442 (PF14539.13), 4HBT (PF03061.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIM3 SwissProt · reviewed · Evidence at protein level
UniProt namePutative esterase Rv1847
EC (curated) EC 3.1.2.-

UniProt still lists this protein as Putative esterase Rv1847; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionPFAM thioesterase superfamily
Orthologous groupCOG2050

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.519 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4442PF14539.13 2.1e-0512–133 Domain of unknown function (DUF4442)
4HBTPF03061.29 4.1e-1748–127 Thioesterase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ureA (urease subunit gamma), high confidence from genomic context alone (score 806 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0548c menB 1,4-dihydroxy-2-naphthoyl-CoA synthase 974 927 database:900 textmining:659
Rv0534c menA 1,4-dihydroxy-2-naphthoate octaprenyltransferase 981 904 database:900 textmining:813
Rv1848 ureA urease subunit gamma 806 806 ctx neighborhood:804
Rv1850 ureC urease subunit alpha 804 805 ctx neighborhood:804
Rv1851 ureF urease accessory protein UreF 801 801 ctx neighborhood:801
Rv1849 ureB urease subunit beta 797 797 ctx neighborhood:796
Rv1852 ureG urease accessory protein UreG 712 713 ctx neighborhood:712
Rv1853 ureD urease accessory protein UreD 712 712 ctx neighborhood:711
Rv2383c mbtB phenyloxazoline synthase 707 666 coexpression:433 experimental:402
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 517 517 ctx neighborhood:515
Rv2524c fas fatty acid synthase 655 513 coexpression:412
Rv1846c blaI transcriptional repressor BlaI 511 512 ctx neighborhood:509
Rv1844c gnd1 6-phosphogluconate dehydrogenase 511 501 ctx neighborhood:496
Rv2307c hyp hypothetical protein 515 497 database:485
Rv2627c hyp hypothetical protein 508 489 database:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: esterase
  • MTBC0 PGAP product: PaaI family thioesterase
  • Pfam (hmmscan --cut_ga): DUF4442 PF14539.13 (E=2e-05), 4HBT PF03061.29 (E=4e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216363.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4442 (PF14539.13), 4HBT (PF03061.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2050
  • Curated reference: UniProt P9WIM3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor ureA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001960|Rv1847|
MQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAAFAWLNSHGEGGSVVGVNNNTDFLRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDRVVARGQVRLQNLEARP