Rv1847 Family assigned · medium auto-curated
H37Rv Rv1847 · MTBC0 mtbc0_001960 ·
140 aa · 2114915–2115337 (+) ·
RefSeq NP_216363.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | esterase |
|---|---|
| MTBC0 PGAP re-annotation | PaaI family thioesterase |
| Revised (this work) | PaaI family thioesterase. Pfam: DUF4442 (PF14539.13), 4HBT (PF03061.29). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WIM3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Putative esterase Rv1847 |
| EC (curated) |
EC 3.1.2.-
|
UniProt still lists this protein as Putative esterase Rv1847; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | PFAM thioesterase superfamily |
| Orthologous group | COG2050 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.519 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4442 | PF14539.13 | 2.1e-05 | 12–133 | Domain of unknown function (DUF4442) |
4HBT | PF03061.29 | 4.1e-17 | 48–127 | Thioesterase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: ureA (urease subunit gamma), high confidence from genomic context alone (score 806 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0548c menB |
1,4-dihydroxy-2-naphthoyl-CoA synthase | 974 | 927 | database:900 textmining:659 |
Rv0534c menA |
1,4-dihydroxy-2-naphthoate octaprenyltransferase | 981 | 904 | database:900 textmining:813 |
Rv1848 ureA |
urease subunit gamma | 806 | 806 ctx | neighborhood:804 |
Rv1850 ureC |
urease subunit alpha | 804 | 805 ctx | neighborhood:804 |
Rv1851 ureF |
urease accessory protein UreF | 801 | 801 ctx | neighborhood:801 |
Rv1849 ureB |
urease subunit beta | 797 | 797 ctx | neighborhood:796 |
Rv1852 ureG |
urease accessory protein UreG | 712 | 713 ctx | neighborhood:712 |
Rv1853 ureD |
urease accessory protein UreD | 712 | 712 ctx | neighborhood:711 |
Rv2383c mbtB |
phenyloxazoline synthase | 707 | 666 | coexpression:433 experimental:402 |
Rv1843c guaB1 |
inosine-5'-monophosphate dehydrogenase | 517 | 517 ctx | neighborhood:515 |
Rv2524c fas |
fatty acid synthase | 655 | 513 | coexpression:412 |
Rv1846c blaI |
transcriptional repressor BlaI | 511 | 512 ctx | neighborhood:509 |
Rv1844c gnd1 |
6-phosphogluconate dehydrogenase | 511 | 501 ctx | neighborhood:496 |
Rv2307c hyp |
hypothetical protein | 515 | 497 | database:485 |
Rv2627c hyp |
hypothetical protein | 508 | 489 | database:485 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: esterase
- MTBC0 PGAP product: PaaI family thioesterase
- Pfam (hmmscan --cut_ga): DUF4442 PF14539.13 (E=2e-05), 4HBT PF03061.29 (E=4e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216363.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4442 (PF14539.13), 4HBT (PF03061.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2050 - Curated reference: UniProt P9WIM3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
ureA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001960|Rv1847| MQPSPDSPAPLNVTVPFDSELGLQFTELGPDGARAQLDVRPKLLQLTGVVHGGVYCAMIESIASMAAFAWLNSHGEGGSVVGVNNNTDFLRSISSGMVYGTAEPLHRGRRQQLWLVTITDDTDRVVARGQVRLQNLEARP