trcR Resolved · high auto-curated

H37Rv Rv1033c · MTBC0 mtbc0_001112 · 257 aa · 1165300–1166073 (-) · RefSeq NP_215549.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component transcriptional regulator TrcR
MTBC0 PGAP re-annotationtwo-component system response regulator TrcR
Revised (this work)Two-component system response regulator TrcR. Pfam: Response_reg (PF00072.31), Trans_reg_C (PF00486.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt L7N689 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulatory protein TrcR
Curated functionMember of the two-component regulatory system TrcS/TrcR. Activates its own expression by binding specifically to the AT-rich sequence of the trcR promoter region. Also negatively regulates the expression of Rv1057 by binding to an AT-rich sequences within the Rv1057 upstream sequence. The TrcR-TrcS regulatory system may act as a transition regulatory system involved in adapting to an intracellular environment and transitioning from latency to reactivation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
T Signal transduction mechanisms
Preferred nametrcR
eggNOG descriptiontranscriptional
Orthologous groupCOG0745
KEGG orthology K02483, K07672
KEGG pathways map02020
KEGG modules M00463

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Response_regPF00072.31 2.9e-2834–143 Response regulator receiver domain
Trans_reg_CPF00486.35 1.1e-26179–253 Transcriptional regulatory protein, C terminal

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trcS (two component sensor histidine kinase TrcS), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1032c trcS two component sensor histidine kinase TrcS 999 999 ctx neighborhood:881 cooccurence:769 database:900 textmining:830
Rv1027c kdpE transcriptional regulator KdpE 922 919 ctx neighborhood:544 coexpression:800
Rv3764c tcrY two component sensor kinase TcrY 915 899 ctx cooccurence:766
Rv0600c two component sensor kinase HK1 913 891 ctx cooccurence:755
Rv0902c prrB two component sensor histidine kinase PrrB 948 888 ctx cooccurence:736 textmining:561
Rv0982 mprB two component histidine-protein kinase/phosphatase MprB 870 866 ctx cooccurence:691
Rv0490 senX3 two component sensor histidine kinase SenX3 887 855 ctx cooccurence:744
Rv0758 phoR two component system response sensor kinase PhoR 896 853 ctx cooccurence:743
Rv0273c transcriptional regulator 831 831 coexpression:831
Rv2488c LuxR family transcriptional regulator 845 828 coexpression:799
Rv3164c moxR3 methanol dehydrogenase transcriptional regulator MoxR 760 759 coexpression:759
Rv3245c mtrB two component sensory histidine kinase MtrB 800 746 ctx cooccurence:558
Rv1151c cobB NAD-dependent protein deacylase 744 735 coexpression:734
Rv1681 moeX molybdopterin biosynthesis protein MoeX 735 734 coexpression:734
Rv3488 hyp hypothetical protein 734 734 coexpression:734

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two component transcriptional regulator TrcR
  • MTBC0 PGAP product: two-component system response regulator TrcR
  • Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=3e-28), Trans_reg_C PF00486.35 (E=1e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215549.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), Trans_reg_C (PF00486.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0745
  • Curated reference: UniProt L7N689 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor trcS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001112|Rv1033c|trcR
MTTMSGYTRSQRPRQAILGQLPRIHRADGSPIRVLLVDDEPALTNLVKMALHYEGWDVEVAHDGQEAIAKFDKVGPDVLVLDIMLPDVDGLEILRRVRESDVYTPTLFLTARDSVMDRVTGLTSGADDYMTKPFSLEELVARLRGLLRRSSHLERPADEALRVGDLTLDGASREVTRDGTPISLSSTEFELLRFLMRNPRRALSRTEILDRVWNYDFAGRTSIVDLYISYLRKKIDSDREPMIHTVRGIGYMLRPPE