ureF Resolved · high auto-curated

H37Rv Rv1851 · MTBC0 mtbc0_001964 · 211 aa · 2117732–2118367 (+) · RefSeq NP_216367.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)urease accessory protein UreF
MTBC0 PGAP re-annotationurease accessory protein UreF
Revised (this work)Urease accessory protein UreF. Pfam: UreF (PF01730.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFE5 SwissProt · reviewed · Inferred from homology
UniProt nameUrease accessory protein UreF
Curated functionRequired for maturation of urease via the functional incorporation of the urease nickel metallocenter.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category O Post-translational modification, protein turnover, chaperones
Preferred nameureF
eggNOG descriptionUrease accessory protein UreF
Orthologous groupCOG0830
KEGG orthology K03188

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.8 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
UreFPF01730.22 8.0e-1836–171 UreF

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ureD (urease accessory protein UreD), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1853 ureD urease accessory protein UreD 999 999 ctx neighborhood:874 cooccurence:774 coexpression:657 experimental:919 textmining:604
Rv1852 ureG urease accessory protein UreG 999 997 ctx neighborhood:874 coexpression:871 experimental:810 textmining:625
Rv1850 ureC urease subunit alpha 996 991 ctx neighborhood:882 coexpression:887 textmining:625
Rv1848 ureA urease subunit gamma 985 982 ctx neighborhood:882 coexpression:785
Rv1849 ureB urease subunit beta 988 971 ctx neighborhood:882 coexpression:654 textmining:625
Rv1847 esterase 801 801 ctx neighborhood:801
Rv0339c iniR transcriptional regulator 601 602 ctx cooccurence:596
Rv0343 iniC iIsoniazid inductible protein IniC 569 569 ctx cooccurence:567
Rv0342 iniA isoniazid inductible protein IniA 560 560 ctx cooccurence:560
Rv2709 transmembrane protein 558 558 ctx cooccurence:556
Rv3903c cpnT hyp hypothetical protein 441 442 ctx cooccurence:436
Rv1648 transmembrane protein 438 439 ctx cooccurence:437
Rv2164c hyp hypothetical protein 429 430 ctx cooccurence:426
Rv1524 glycosyltransferase 421 422 ctx cooccurence:413
Rv1526c glycosyltransferase 406 407 ctx cooccurence:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: urease accessory protein UreF
  • MTBC0 PGAP product: urease accessory protein UreF
  • Pfam (hmmscan --cut_ga): UreF PF01730.22 (E=8e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216367.1)
  • Domains: Pfam-A via hmmscan --cut_ga — UreF (PF01730.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0830
  • Curated reference: UniProt P9WFE5 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor ureD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001964|Rv1851|ureF
MTSLAVLLTLADSRLPTGAHVHSGGIEEAIAAGMVTGLATLEAFLKRRVRTHGLLTASIAAAVHRGELAVDDADRETDARTPAPAARHASRSQGRGLIRLARRVWPDSGWEELGPRPHLAVVAGRVGALSGLAPEHNALHLVYITMTGSAIAAQRLLALDPAEVTVVTFQLSELCEQIAQEATAGLADLSDPLLDTLAQRHDERVRPLFVS