moaB2 Family assigned · medium auto-curated

H37Rv Rv0984 · MTBC0 mtbc0_001055 · 181 aa · 1107796–1108341 (+) · RefSeq NP_215499.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)pterin-4-alpha-carbinolamine dehydratase
MTBC0 PGAP re-annotationMogA/MoaB family molybdenum cofactor biosynthesis protein
Revised (this work)MogA/MoaB family molybdenum cofactor biosynthesis protein. Pfam: MoCF_biosynth (PF00994.30).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53897 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMoaB/Mog domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namemoaB
eggNOG descriptionmolybdenum cofactor
Orthologous groupCOG0521
EC number EC 4.2.1.96
KEGG orthology K01724
KEGG pathways map00790

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.376 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MoCF_biosynthPF00994.30 6.5e-2430–167 Probable molybdopterin binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pepD (serine protease PepD), high confidence from genomic context alone (score 982 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0983 pepD serine protease PepD 981 982 ctx neighborhood:881 coexpression:853
Rv0864 moaC2 cyclic pyranopterin monophosphate synthase accessory protein 915 900 ctx cooccurence:737 coexpression:443
Rv3324c moaC3 cyclic pyranopterin monophosphate synthase accessory protein 902 877 ctx cooccurence:726 coexpression:437
Rv3111 moaC1 cyclic pyranopterin monophosphate synthase accessory protein 915 872 ctx cooccurence:723 coexpression:439
Rv0869c moaA2 molybdenum cofactor biosynthesis protein MoaA 971 822 ctx cooccurence:747 textmining:844
Rv0438c moeA2 molybdopterin molybdenumtransferase 856 812 ctx cooccurence:749
Rv0994 moeA1 molybdopterin molybdenumtransferase 1 890 811 ctx cooccurence:744 textmining:446
Rv3109 moaA1 cyclic pyranopterin monophosphate synthase 920 798 ctx cooccurence:714 textmining:624
Rv0982 mprB two component histidine-protein kinase/phosphatase MprB 817 790 ctx neighborhood:693
Rv0866 moaE2 molybdopterin synthase catalytic subunit 2 974 778 ctx fusion:507 coexpression:415 textmining:888
Rv3323c moaX MoaD-MoaE fusion protein MoaX 852 762 coexpression:685 textmining:405
Rv0981 mprA two-component response regulator MrpA 840 693 ctx neighborhood:678 textmining:502
Rv0563 htpX protease HtpX 653 654 coexpression:651
Rv0979A rpmF 50S ribosomal protein L32 545 545 ctx neighborhood:544
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 539 510 coexpression:418

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: pterin-4-alpha-carbinolamine dehydratase
  • MTBC0 PGAP product: MogA/MoaB family molybdenum cofactor biosynthesis protein
  • Pfam (hmmscan --cut_ga): MoCF_biosynth PF00994.30 (E=6e-24)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215499.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MoCF_biosynth (PF00994.30)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0521
  • Curated reference: UniProt O53897 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor pepD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001055|Rv0984|moaB2
MKVAAQCSKLGYTVAPMEQRAELVVGRALVVVVDDRTAHGDEDHSGPLVTELLTEAGFVVDGVVAVSADEVEIRNALNTAVIGGVDLVVSVGGTGVTPRDVTPEATRDILDREILGIAEAIRASGLSAGIVDAGLSRGLAGVSGSTLVVNLAGSRYAVRDGMATLNPLAAQIIGQLSSLEI