moaB2 Family assigned · medium auto-curated
H37Rv Rv0984 · MTBC0 mtbc0_001055 ·
181 aa ·
1107796–1108341 MTBC0
(+) ·
RefSeq NP_215499.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | pterin-4-alpha-carbinolamine dehydratase |
|---|---|
| MTBC0 PGAP re-annotation | MogA/MoaB family molybdenum cofactor biosynthesis protein |
| Revised (this work) | MogA/MoaB family molybdenum cofactor biosynthesis protein. Pfam: MoCF_biosynth (PF00994.30). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| MoaB2, a newly identified transcription factor, binds to σA in Mycobacterium smegmatis. doi:10.1128/jb.00066-24 | 2024 |
| Transcriptional signatures of Mycobacterium tuberculosis in mouse model of intraocular tuberculosis. doi:10.1093/femspd/ftz045 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | pepD (Rv0983, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -0.45 (95% CI -6.97 to 6.03). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in molybdopterin biosynthesis. Catalyzes the dehydratation of 4A-hydroxytetrahydropterins [catalytic activity: (6R)-6-(L-erythro-1,2-dihydroxypropyl)-5,6,7,8-tetrahydro-4A-hydroxypterin = (6R)-6-(L-erythro-1,2- dihydroxypropyl)-7,8-dihydro-6H-pterin + H(2)O.]. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1010
· 100.0% identity |
|---|---|
| M. leprae |
ML0177
· 88.8% identity |
| M. marinum |
MMAR_4526
· 94.4% identity |
| M. smegmatis |
MSMEG_5485
· 84.9% identity |
| M. orygis |
RJtmp_001039
· 100.0% identity |
| M. abscessus |
MAB_1079
· 63.9% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53897
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | MoaB/Mog domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | moaB |
| eggNOG description | molybdenum cofactor |
| Orthologous group | COG0521 |
| EC number |
EC 4.2.1.96
|
| KEGG orthology |
K01724
|
| KEGG pathways |
map00790
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.376 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 93.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.9% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 0.800, mean read count 135.75. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) stress
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| Dimethyl Sulfoxide | stress | mutant enriched (loss advantageous) | 1.403 | 5.453 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 867.0 ppm · rank 262/3519 (92.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 181 aa |
|---|---|
| Molecular weight | 18.4 kDa |
| Theoretical pI | 4.53 |
| GRAVY | 0.412 (hydrophobic) |
| Aliphatic index | 118.5 |
| Aromaticity | 0.017 |
| Instability index | 13.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MoCF_biosynth | PF00994.30 | 6.5e-24 | 30–167 | Probable molybdopterin binding domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 90.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8byr-assembly1_B |
1.00 | 0.99 | 1.1e-27 sig | 8byr-assembly1_B Crystal structure of MoaB2 protein from Mycobacterium smegmatis |
3rfq-assembly1_C |
1.00 | 0.99 | 6.1e-27 sig | 3rfq-assembly1_C Crystal structure of Pterin-4-alpha-carbinolamine dehydratase MoaB2 from Mycobacterium marinum |
8byr-assembly1_E |
1.00 | 0.99 | 1.7e-25 sig | 8byr-assembly1_E Crystal structure of MoaB2 protein from Mycobacterium smegmatis |
8byr-assembly1_F |
1.00 | 0.98 | 2.2e-25 sig | 8byr-assembly1_F Crystal structure of MoaB2 protein from Mycobacterium smegmatis |
8byr-assembly1_D |
1.00 | 0.98 | 5.0e-25 sig | 8byr-assembly1_D Crystal structure of MoaB2 protein from Mycobacterium smegmatis |
Foldseek search of the AlphaFold DB model (mean pLDDT 90.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | pepD (+ strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | mscL (- strand, 19 bp gap) |
| Predicted operon |
mprA · mprB · pepD · moaB2
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pepD (serine protease PepD), high confidence from genomic context alone (score 982 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0983 pepD |
serine protease PepD | 981 | 982 ctx | neighborhood:881 coexpression:853 |
Rv0864 moaC2 |
cyclic pyranopterin monophosphate synthase accessory protein | 915 | 900 ctx | cooccurence:737 coexpression:443 |
Rv3324c moaC3 |
cyclic pyranopterin monophosphate synthase accessory protein | 902 | 877 ctx | cooccurence:726 coexpression:437 |
Rv3111 moaC1 |
cyclic pyranopterin monophosphate synthase accessory protein | 915 | 872 ctx | cooccurence:723 coexpression:439 |
Rv0869c moaA2 |
molybdenum cofactor biosynthesis protein MoaA | 971 | 822 ctx | cooccurence:747 textmining:844 |
Rv0438c moeA2 |
molybdopterin molybdenumtransferase | 856 | 812 ctx | cooccurence:749 |
Rv0994 moeA1 |
molybdopterin molybdenumtransferase 1 | 890 | 811 ctx | cooccurence:744 textmining:446 |
Rv3109 moaA1 |
cyclic pyranopterin monophosphate synthase | 920 | 798 ctx | cooccurence:714 textmining:624 |
Rv0982 mprB |
two component histidine-protein kinase/phosphatase MprB | 817 | 790 ctx | neighborhood:693 |
Rv0866 moaE2 |
molybdopterin synthase catalytic subunit 2 | 974 | 778 ctx | fusion:507 coexpression:415 textmining:888 |
Rv3323c moaX |
MoaD-MoaE fusion protein MoaX | 852 | 762 | coexpression:685 textmining:405 |
Rv0981 mprA |
two-component response regulator MrpA | 840 | 693 ctx | neighborhood:678 textmining:502 |
Rv0563 htpX |
protease HtpX | 653 | 654 | coexpression:651 |
Rv0979A rpmF |
50S ribosomal protein L32 | 545 | 545 ctx | neighborhood:544 |
Rv3119 moaE1 |
molybdopterin synthase catalytic subunit 1 | 539 | 510 | coexpression:418 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: pterin-4-alpha-carbinolamine dehydratase
- MTBC0 PGAP product: MogA/MoaB family molybdenum cofactor biosynthesis protein
- Pfam (hmmscan --cut_ga): MoCF_biosynth PF00994.30 (E=6e-24)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215499.1)
- Domains: Pfam-A via hmmscan --cut_ga — MoCF_biosynth (PF00994.30)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0521 - Curated reference: UniProt O53897 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 90.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
pepD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001055|Rv0984|moaB2 MKVAAQCSKLGYTVAPMEQRAELVVGRALVVVVDDRTAHGDEDHSGPLVTELLTEAGFVVDGVVAVSADEVEIRNALNTAVIGGVDLVVSVGGTGVTPRDVTPEATRDILDREILGIAEAIRASGLSAGIVDAGLSRGLAGVSGSTLVVNLAGSRYAVRDGMATLNPLAAQIIGQLSSLEI
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for moaB2? Email the maintainer — the message is pre-filled with this gene's details.