blaI Resolved · high auto-curated
H37Rv Rv1846c · MTBC0 mtbc0_001959 ·
138 aa · 2114221–2114637 (-) ·
RefSeq NP_216362.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transcriptional repressor BlaI |
|---|---|
| MTBC0 PGAP re-annotation | transcriptional repressor BlaI |
| Revised (this work) | Transcriptional repressor BlaI. Pfam: Penicillinase_R (PF03965.23). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMJ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulator BlaI |
| Curated function | Transcription regulator that binds to an inverted DNA repeat with the consensus sequence 5'-TAC[GT]AC-NNNNN-GT[AC]GTA-3' and regulates genes involved in antibiotic transport, detoxification and cell wall function. Also regulates its own transcription. Binds DNA as a dimer. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | blaI |
| eggNOG description | Transcriptional regulator |
| Orthologous group | COG3682 |
| Gene Ontology (28) |
GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323 +16 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.274 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Penicillinase_R | PF03965.23 | 3.7e-28 | 7–120 | Penicillinase repressor |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: blaR (sensor-transducer protein BlaR), high confidence from genomic context alone (score 976 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1845c blaR |
sensor-transducer protein BlaR | 976 | 976 ctx | neighborhood:869 cooccurence:772 |
Rv1843c guaB1 |
inosine-5'-monophosphate dehydrogenase | 830 | 830 ctx | neighborhood:794 |
Rv1844c gnd1 |
6-phosphogluconate dehydrogenase | 760 | 761 ctx | neighborhood:748 |
Rv1842c hyp |
hypothetical protein | 699 | 699 ctx | neighborhood:695 |
Rv1841c hyp |
hypothetical protein | 698 | 698 ctx | neighborhood:695 |
Rv1847 |
esterase | 511 | 512 ctx | neighborhood:509 |
Rv3418c groES |
chaperonin GroES | 414 | 415 | coexpression:415 |
Rv0351 grpE |
stress response protein GrpE | 413 | 414 | coexpression:414 |
Rv1837c glcB |
malate synthase | 410 | 410 ctx | neighborhood:401 |
Rv0184 hyp |
hypothetical protein | 408 | 409 ctx | cooccurence:405 |
Rv1848 ureA |
urease subunit gamma | 402 | 402 | |
Rv0276 hyp |
hypothetical protein | 460 | 347 | |
Rv2506 |
TetR family transcriptional regulator | 687 | 189 | textmining:630 |
Rv2788 sirR |
transcriptional repressor SirR | 492 | 67 | textmining:479 |
Rv0188 |
transmembrane protein | 445 | 55 | textmining:437 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transcriptional repressor BlaI
- MTBC0 PGAP product: transcriptional repressor BlaI
- Pfam (hmmscan --cut_ga): Penicillinase_R PF03965.23 (E=4e-28)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216362.1)
- Domains: Pfam-A via hmmscan --cut_ga — Penicillinase_R (PF03965.23)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3682 - Curated reference: UniProt P9WMJ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
17 functional partner(s); context anchor
blaR - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001959|Rv1846c|blaI MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQIRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEAGHGNRPPAGAATET