blaI Resolved · high auto-curated

H37Rv Rv1846c · MTBC0 mtbc0_001959 · 138 aa · 2114221–2114637 (-) · RefSeq NP_216362.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transcriptional repressor BlaI
MTBC0 PGAP re-annotationtranscriptional repressor BlaI
Revised (this work)Transcriptional repressor BlaI. Pfam: Penicillinase_R (PF03965.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMJ5 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulator BlaI
Curated functionTranscription regulator that binds to an inverted DNA repeat with the consensus sequence 5'-TAC[GT]AC-NNNNN-GT[AC]GTA-3' and regulates genes involved in antibiotic transport, detoxification and cell wall function. Also regulates its own transcription. Binds DNA as a dimer.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameblaI
eggNOG descriptionTranscriptional regulator
Orthologous groupCOG3682
Gene Ontology (28) GO:0003674, GO:0003676, GO:0003677, GO:0005488, GO:0006355, GO:0008150, GO:0009889, GO:0010468, GO:0010556, GO:0019219, GO:0019222, GO:0031323 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.274 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Penicillinase_RPF03965.23 3.7e-287–120 Penicillinase repressor

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: blaR (sensor-transducer protein BlaR), high confidence from genomic context alone (score 976 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1845c blaR sensor-transducer protein BlaR 976 976 ctx neighborhood:869 cooccurence:772
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 830 830 ctx neighborhood:794
Rv1844c gnd1 6-phosphogluconate dehydrogenase 760 761 ctx neighborhood:748
Rv1842c hyp hypothetical protein 699 699 ctx neighborhood:695
Rv1841c hyp hypothetical protein 698 698 ctx neighborhood:695
Rv1847 esterase 511 512 ctx neighborhood:509
Rv3418c groES chaperonin GroES 414 415 coexpression:415
Rv0351 grpE stress response protein GrpE 413 414 coexpression:414
Rv1837c glcB malate synthase 410 410 ctx neighborhood:401
Rv0184 hyp hypothetical protein 408 409 ctx cooccurence:405
Rv1848 ureA urease subunit gamma 402 402
Rv0276 hyp hypothetical protein 460 347
Rv2506 TetR family transcriptional regulator 687 189 textmining:630
Rv2788 sirR transcriptional repressor SirR 492 67 textmining:479
Rv0188 transmembrane protein 445 55 textmining:437

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transcriptional repressor BlaI
  • MTBC0 PGAP product: transcriptional repressor BlaI
  • Pfam (hmmscan --cut_ga): Penicillinase_R PF03965.23 (E=4e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216362.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Penicillinase_R (PF03965.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3682
  • Curated reference: UniProt P9WMJ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor blaR
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001959|Rv1846c|blaI
MAKLTRLGDLERAVMDHLWSRTEPQTVRQVHEALSARRDLAYTTVMTVLQRLAKKNLVLQIRDDRAHRYAPVHGRDELVAGLMVDALAQAEDSGSRQAALVHFVERVGADEADALRRALAELEAGHGNRPPAGAATET