ureB Family assigned · medium auto-curated

H37Rv Rv1849 · MTBC0 mtbc0_001962 · 104 aa · 2115685–2115999 (+) · RefSeq NP_216365.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)urease subunit beta
MTBC0 PGAP re-annotationurease subunit beta
Revised (this work)Urease subunit beta. Pfam: Urease_beta (PF00699.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFE9 SwissProt · reviewed · Evidence at protein level
UniProt nameUrease subunit beta
EC (curated) EC 3.5.1.5

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred nameureB
eggNOG descriptionBelongs to the urease beta subunit family
Orthologous groupCOG0832
EC number EC 3.5.1.5
KEGG orthology K01429, K14048
KEGG pathways map00220, map00230, map00791, map01100, map01120, map05120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.712 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Urease_betaPF00699.26 2.0e-353–96 Urease beta subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: ureC (urease subunit alpha), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1850 ureC urease subunit alpha 999 1000 ctx neighborhood:882 fusion:706 cooccurence:774 coexpression:883 experimental:928 database:900 textmining:707
Rv1848 ureA urease subunit gamma 999 1000 ctx neighborhood:882 fusion:899 cooccurence:774 coexpression:880 experimental:927 database:900 textmining:845
Rv1852 ureG urease accessory protein UreG 996 989 ctx neighborhood:874 cooccurence:774 coexpression:656 textmining:704
Rv1851 ureF urease accessory protein UreF 988 971 ctx neighborhood:882 coexpression:654 textmining:625
Rv1853 ureD urease accessory protein UreD 987 971 ctx neighborhood:874 coexpression:747 textmining:592
Rv1847 esterase 797 797 ctx neighborhood:796
Rv1843c guaB1 inosine-5'-monophosphate dehydrogenase 487 330
Rv2747 argA L-glutamate alpha-N-acetyltranferase 666 61 textmining:659
Rv2367c ybeY endoribonuclease 702 51 textmining:699
Rv3859c gltB glutamate synthase large subunit 539 42 textmining:539

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: urease subunit beta
  • MTBC0 PGAP product: urease subunit beta
  • Pfam (hmmscan --cut_ga): Urease_beta PF00699.26 (E=2e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216365.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Urease_beta (PF00699.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0832
  • Curated reference: UniProt P9WFE9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor ureC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001962|Rv1849|ureB
MIPGEIFYGSGDIEMNAAALSRLQMRIINAGDRPVQVGSHVHLPQANRALSFDRATAHGYRLDIPAATAVRFEPGIPQIVGLVPLGGRREVPGLTLNPPGRLDR