Rv1592c Family assigned · medium auto-curated
H37Rv Rv1592c · MTBC0 mtbc0_001698 ·
446 aa · 1804364–1805704 (-) ·
RefSeq NP_216108.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | lipase family protein |
| Revised (this work) | Lipase family protein. Pfam: LIP (PF03583.21). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WK89
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable inactive lipase Rv1592c |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Secretory lipase |
| Orthologous group | COG1073 |
| EC number |
EC 3.1.1.3
|
| KEGG orthology |
K01046
|
| KEGG pathways |
map00561, map01100
|
| KEGG modules |
M00098
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.423 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LIP | PF03583.21 | 3.8e-106 | 129–406 | Secretory lipase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cfp21 (cutinase), medium confidence from genomic context alone (score 636 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1013 pks16 |
polyketide synthase | 737 | 737 | coexpression:736 |
Rv1984c cfp21 |
cutinase | 636 | 636 ctx | cooccurence:633 |
Rv3451 cut3 |
cutinase | 575 | 576 ctx | cooccurence:566 |
Rv3452 cut4 |
cutinase | 572 | 572 ctx | cooccurence:571 |
Rv1593c hyp |
hypothetical protein | 535 | 535 ctx | neighborhood:532 |
Rv2301 cut2 |
cutinase | 534 | 534 ctx | cooccurence:527 |
Rv1758 cut1 |
cutinase | 527 | 528 ctx | cooccurence:522 |
Rv1780 hyp |
hypothetical protein | 459 | 460 ctx | cooccurence:457 |
Rv2716 hyp |
hypothetical protein | 446 | 446 ctx | cooccurence:406 |
Rv1832 gcvB |
glycine dehydrogenase | 444 | 445 | coexpression:426 |
Rv1596 nadC |
nicotinate-nucleotide pyrophosphatase | 418 | 418 ctx | neighborhood:411 |
Rv1594 nadA |
quinolinate synthetase A | 408 | 408 ctx | neighborhood:401 |
Rv1595 nadB |
L-aspartate oxidase | 407 | 407 ctx | neighborhood:401 |
Rv0129c fbpC |
diacylglycerol acyltransferase/mycolyltransferase Ag85C | 624 | 252 | textmining:519 |
Rv2247 accD6 |
acetyl-/propionyl-CoA carboxylase subunit beta | 469 | 187 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: lipase family protein
- Pfam (hmmscan --cut_ga): LIP PF03583.21 (E=4e-106)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216108.1)
- Domains: Pfam-A via hmmscan --cut_ga — LIP (PF03583.21)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1073 - Curated reference: UniProt P9WK89 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
cfp21 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001698|Rv1592c| MVEPGNLAGATGAEWIGRPPHEELQRKVRPLLPSDDPFYFPPAGYQHAVPGTVLRSRDVELAFMGLIPQPVTATQLLYRTTNMYGNPEATVTTVIVPAELAPGQTCPLLSYQCAIDAMSSRCFPSYALRRRAKALGSLTQMELLMISAALAEGWAVSVPDHEGPKGLWGSPYEPGYRVLDGIRAALNSERVGLSPATPIGLWGYSGGGLASAWAAEACGEYAPDLDIVGAVLGSPVGDLGHTFRRLNGTLLAGLPALVVAALQHSYPGLARVIKEHANDEGRQLLEQLTEMTTVDAVIRMAGRDMGDFLDEPLEDILSTPEVSHVFGDTKLGSAVPTPPVLIVQAVHDYLIDVSDIDALADSYTAGGANVTYHRDLFSEHVSLHPLSAPMTLRWLTDRFAGKPLTDHRVRTTWPTIFNPMTYAGMARLAVIAAKVITGRKLSRRPL