Rv1592c Family assigned · medium auto-curated

H37Rv Rv1592c · MTBC0 mtbc0_001698 · 446 aa · 1804364–1805704 (-) · RefSeq NP_216108.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationlipase family protein
Revised (this work)Lipase family protein. Pfam: LIP (PF03583.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK89 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable inactive lipase Rv1592c

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSecretory lipase
Orthologous groupCOG1073
EC number EC 3.1.1.3
KEGG orthology K01046
KEGG pathways map00561, map01100
KEGG modules M00098

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.423 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LIPPF03583.21 3.8e-106129–406 Secretory lipase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cfp21 (cutinase), medium confidence from genomic context alone (score 636 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1013 pks16 polyketide synthase 737 737 coexpression:736
Rv1984c cfp21 cutinase 636 636 ctx cooccurence:633
Rv3451 cut3 cutinase 575 576 ctx cooccurence:566
Rv3452 cut4 cutinase 572 572 ctx cooccurence:571
Rv1593c hyp hypothetical protein 535 535 ctx neighborhood:532
Rv2301 cut2 cutinase 534 534 ctx cooccurence:527
Rv1758 cut1 cutinase 527 528 ctx cooccurence:522
Rv1780 hyp hypothetical protein 459 460 ctx cooccurence:457
Rv2716 hyp hypothetical protein 446 446 ctx cooccurence:406
Rv1832 gcvB glycine dehydrogenase 444 445 coexpression:426
Rv1596 nadC nicotinate-nucleotide pyrophosphatase 418 418 ctx neighborhood:411
Rv1594 nadA quinolinate synthetase A 408 408 ctx neighborhood:401
Rv1595 nadB L-aspartate oxidase 407 407 ctx neighborhood:401
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 624 252 textmining:519
Rv2247 accD6 acetyl-/propionyl-CoA carboxylase subunit beta 469 187

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: lipase family protein
  • Pfam (hmmscan --cut_ga): LIP PF03583.21 (E=4e-106)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216108.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LIP (PF03583.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1073
  • Curated reference: UniProt P9WK89 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor cfp21
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001698|Rv1592c|
MVEPGNLAGATGAEWIGRPPHEELQRKVRPLLPSDDPFYFPPAGYQHAVPGTVLRSRDVELAFMGLIPQPVTATQLLYRTTNMYGNPEATVTTVIVPAELAPGQTCPLLSYQCAIDAMSSRCFPSYALRRRAKALGSLTQMELLMISAALAEGWAVSVPDHEGPKGLWGSPYEPGYRVLDGIRAALNSERVGLSPATPIGLWGYSGGGLASAWAAEACGEYAPDLDIVGAVLGSPVGDLGHTFRRLNGTLLAGLPALVVAALQHSYPGLARVIKEHANDEGRQLLEQLTEMTTVDAVIRMAGRDMGDFLDEPLEDILSTPEVSHVFGDTKLGSAVPTPPVLIVQAVHDYLIDVSDIDALADSYTAGGANVTYHRDLFSEHVSLHPLSAPMTLRWLTDRFAGKPLTDHRVRTTWPTIFNPMTYAGMARLAVIAAKVITGRKLSRRPL