Rv1586c Family assigned · low auto-curated

H37Rv Rv1586c · MTBC0 mtbc0_001693 · 115 aa · 1799056–1800469 (-) · RefSeq NP_216102.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage integrase
MTBC0 PGAP re-annotationrecombinase family protein
Revised (this work)Recombinase family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06604 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable PhiRv1 integrase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionRecombinase
Orthologous groupCOG1961

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (221) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1585c (phage protein), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1585c phage protein 971 971 ctx neighborhood:801 coexpression:860
Rv1587c hyp hypothetical protein 882 882 ctx neighborhood:780
Rv1588c hyp hypothetical protein 786 786 ctx neighborhood:780
Rv1582c phage protein 802 757 ctx neighborhood:634
Rv1584c phage protein 857 630 ctx neighborhood:618 textmining:630
Rv1583c phage protein 612 611 ctx neighborhood:606
Rv1140 integral membrane protein 431 431
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 448 426 coexpression:424
Rv2877c integral membrane protein 426 426 coexpression:425
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 425 425 coexpression:424
Rv0784 hyp hypothetical protein 416 417 coexpression:417
Rv1107c xseB exodeoxyribonuclease VII small subunit 408 408 coexpression:408
Rv1576c phage capsid protein 866 351 textmining:803
Rv1997 ctpF cation transporter ATPase F 456 243
Rv0888 spmT hyp hypothetical protein 577 124 textmining:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phage integrase
  • MTBC0 PGAP product: recombinase family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216102.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1961
  • Curated reference: UniProt O06604 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv1585c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001693|Rv1586c|
MRYTTPVRAAVYLRISEDRSGEQLGVARQREDCLKLCGQRKWVPVEYLDNDVSPHQPASAAPNLRADVGRHHRRQDRRRGGLGPGPAPSPSHRAGSLHVISRREAAGPGHRRRRR