Rv1586c Family assigned · low auto-curated

H37Rv Rv1586c · MTBC0 mtbc0_001693 · 115 aa · 1799056–1800469 MTBC0 (-) · RefSeq NP_216102.1

⚠ The ancestral MTBC0 ORF appears truncated by an internal (premature) stop codon: the translated ancestral protein (115 aa) is shorter than its annotated CDS span (≈470 aa / 1414 bp). This is expected for degraded mobile elements (phage, IS, transposase); for a conserved gene it more likely reflects a reconstruction artefact in MTBC0 v1.1. Note: the structural and functional layers below were computed on the translated (truncated) sequence.

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand bioA (Rv1568) — requalified: adenosylmethionine--8-amino-7-oxononanoate transaminase bioA bioD (Rv1570) — requalified: dethiobiotin synthase Rv1571 (Rv1571) — family_assigned: 2'-5' RNA ligase family protein Rv1573 (Rv1573) — dark: hypothetical protein Rv1576c (Rv1576c) — requalified: phage major capsid protein Rv1576c Rv1578c (Rv1578c) — family_assigned: phage terminase small subunit P27 family est12 (Rv1579c) — requalified: hypothetical protein Rv1580c (Rv1580c) — family_assigned: hypothetical protein Rv1581c (Rv1581c) — dark: hypothetical protein Rv1582c (Rv1582c) — family_assigned: phage/plasmid primase%2C P4 family Rv1582c Rv1583c (Rv1583c) — dark: DUF2742 domain-containing protein Rv1584c (Rv1584c) — family_assigned: hypothetical protein Rv1585c (Rv1585c) — family_assigned: hypothetical protein Rv1586c (Rv1586c) — family_assigned: recombinase family protein Rv1586c bioB (Rv1589) — requalified: biotin synthase BioB bioB Rv1590 (Rv1590) — family_assigned: hypothetical protein Rv1591 (Rv1591) — dark: DUF2567 domain-containing protein Rv1592c (Rv1592c) — family_assigned: lipase family protein Rv1592c Rv1593c (Rv1593c) — family_assigned: NUDIX domain-containing protein nadB (Rv1595) — requalified: L-aspartate oxidase nadB nadC (Rv1596) — requalified: carboxylating nicotinate-nucleotide diphosphorylase nadC Rv1597 (Rv1597) — family_assigned: methyltransferase domain-containing protein Rv1598c (Rv1598c) — family_assigned: nitroreductase family deazaflavin-dependent oxidoreductase hisD (Rv1599) — requalified: histidinol dehydrogenase 1 788 kb 1 792 kb 1 796 kb 1 800 kb 1 804 kb 1 808 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage integrase
MTBC0 PGAP re-annotationrecombinase family protein
Revised (this work)Recombinase family protein.
Functional category (TubercuList)insertion seqs and phages

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 2 publications

2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).

PublicationDate
A proof of concept study on the diagnostic utility of in vivo expressed mycobacterial transcripts in tuberculous pleuritis. doi:10.1038/s41598-026-42637-2 2026
Integration and excision of the Mycobacterium tuberculosis prophage-like element, phiRv1. doi:10.1046/j.1365-2958.2002.03130.x 2002

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder98% of residues (metapredict) · mean AlphaFold pLDDT 85.4
Disordered regions1 IDR(s), longest 115 aa [0-115]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Genomic-neighbour overlap (structural caveat) co-directional · 24 % of gene

NeighbourRv1587c (Rv1587c, - strand)
Overlap344 bp, 24 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

Conditional expression context (iModulons)

Member of 2 independently-modulated gene set(s): PyrR (pyrR), Rv0576 (Rv0576).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.38 (95% CI -0.04 to 3.71). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionIntegration of phiRv1 into chromosome.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1612c · 99.8% identity
M. marinum MMAR_2129 · 33.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O06604 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable PhiRv1 integrase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionRecombinase
Orthologous groupCOG1961

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (221) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) MTBC-specific

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 0/53 (0%) · 0/4 closest MTBAP relatives
NOT MTBC-specific despite passing the strict presence filter: no hit at pident>=30 & qcov>=50 across the 53 non-MTBC genomes, BUT sub-threshold tblastn hit(s) exist (M_kansasii:76.6id/41cov;n=19;mtbap=2) — the gene is PRESENT BUT DIVERGENT in at least one non-MTBC Mycobacterium, not a genus-level innovation. Do not frame as MTBC-specific nor as a host-adaptation factor. Human non-homology, if needed, must be established directly (BLASTp vs human proteome), never inferred from this field.
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs)

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Regions of Difference (lineage deletions)

RDGene overlapDeleted in lineages
RD3 100% L2, L7, L4.12, L4.14, L6, L9, Microti, Orygis, Canettii (98%), L4.3 (92%), L4.7 (83%), L4.2 (62%)
149 100% L2, L7, L4.12, L4.14, L6, L9, Microti, Orygis, Canettii (98%), L4.3 (92%), L4.7 (83%), L4.2 (62%)
DS5 100% L2, L7, L4.12, L4.14, L6, L9, Microti, Orygis, Canettii (98%), L4.3 (92%), L4.7 (83%), L4.2 (62%)

This locus overlaps a Region of Difference — a large deletion that is absent in the listed lineages (from the consolidated MTBC RD analysis over ~145 000 strains; H37Rv coordinates). The gene-overlap column is the fraction of the gene inside the RD. RD deletions are classic lineage markers (e.g. RD9 absent in the animal / M. africanum lineages); a gene deleted in a whole lineage is dispensable there.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 24 in the ORF — 0 in the essential state, 0 growth-defect, 24 non-essential, 0 growth-advantage. Saturation 0.917, mean read count 106.318181818. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) -4.570.011 required
Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) -4.270.0 required
Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) -2.830.02 required
Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) -2.340.017 required

Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance16.4 ppm · rank 2449/3519 (30.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length115 aa
Molecular weight13.0 kDa
Theoretical pI11.49
GRAVY-1.063 (hydrophilic)
Aliphatic index63.7
Aromaticity0.035
Instability index90.0 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.4

PDB hitprobTM-scoreE-valueDescription
4kis-assembly1_A 1.00 0.42 6.8e-10 sig 4kis-assembly1_A Crystal Structure of a LSR-DNA Complex
4kis-assembly3_C 1.00 0.41 6.4e-10 sig 4kis-assembly3_C Crystal Structure of a LSR-DNA Complex
4kis-assembly2_B 1.00 0.39 1.7e-09 sig 4kis-assembly2_B Crystal Structure of a LSR-DNA Complex
3guv-assembly1_A-2 1.00 0.66 8.3e-06 sig 3guv-assembly1_A-2 Crystal structure of a resolvase family site-specific recombinase from Streptococcus pneumoniae
3bvp-assembly1_A-2 1.00 0.72 1.4e-05 sig 3bvp-assembly1_A-2 Crystal Structure of the N-terminal Catalytic Domain of TP901-1 Integrase

Foldseek search of the AlphaFold DB model (mean pLDDT 85.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 4

Upstream (5' on genome)Rv1585c (- strand, -4 bp gap)
Downstream (3' on genome)Rv1587c (- strand, -344 bp gap)
Predicted operon Rv1585c · Rv1586c · Rv1587c · Rv1588c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (2 TF) Rv1049 (represses) · lrpA (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv1585c (phage protein), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1585c phage protein 971 971 ctx neighborhood:801 coexpression:860
Rv1587c hyp hypothetical protein 882 882 ctx neighborhood:780
Rv1588c hyp hypothetical protein 786 786 ctx neighborhood:780
Rv1582c phage protein 802 757 ctx neighborhood:634
Rv1584c phage protein 857 630 ctx neighborhood:618 textmining:630
Rv1583c phage protein 612 611 ctx neighborhood:606
Rv1140 integral membrane protein 431 431
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 448 426 coexpression:424
Rv2877c integral membrane protein 426 426 coexpression:425
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 425 425 coexpression:424
Rv0784 hyp hypothetical protein 416 417 coexpression:417
Rv1107c xseB exodeoxyribonuclease VII small subunit 408 408 coexpression:408
Rv1576c phage capsid protein 866 351 textmining:803
Rv1997 ctpF cation transporter ATPase F 456 243
Rv0888 spmT hyp hypothetical protein 577 124 textmining:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phage integrase
  • MTBC0 PGAP product: recombinase family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216102.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1961
  • Curated reference: UniProt O06604 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor Rv1585c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Regions of Difference: consolidated MTBC RD analysis (H37Rv coordinates); RD framework from Brosch et al. 2002 (doi:10.1073/pnas.052548299) and Gagneux & Small 2007 (doi:10.1016/S1473-3099(07)70108-1)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001693|Rv1586c|
MRYTTPVRAAVYLRISEDRSGEQLGVARQREDCLKLCGQRKWVPVEYLDNDVSPHQPASAAPNLRADVGRHHRRQDRRRGGLGPGPAPSPSHRAGSLHVISRREAAGPGHRRRRR