Rv1598c Family assigned · medium auto-curated

H37Rv Rv1598c · MTBC0 mtbc0_001704 · 136 aa · 1811037–1811447 (-) · RefSeq NP_216114.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationnitroreductase family deazaflavin-dependent oxidoreductase
Revised (this work)Nitroreductase family deazaflavin-dependent oxidoreductase. Pfam: F420H2_quin_red (PF04075.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06592 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptiondeazaflavin-dependent nitroreductase family protein
Orthologous group2C2H7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.034 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
F420H2_quin_redPF04075.21 3.9e-0523–95 F420H(2)-dependent quinone reductase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmpL5 (transmembrane transport protein MmpL5), high confidence from genomic context alone (score 725 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0676c mmpL5 transmembrane transport protein MmpL5 724 725 ctx cooccurence:724
Rv0290 eccD3 ESX-3 secretion system protein EccD 709 709 ctx cooccurence:709
Rv2339 mmpL9 transmembrane transport protein MmpL9 702 703 ctx cooccurence:702
Rv0507 mmpL2 transmembrane transport protein MmpL2 700 701 ctx cooccurence:699
Rv0450c mmpL4 transmembrane transport protein MmpL4 693 693 ctx cooccurence:693
Rv0402c mmpL1 transmembrane transport protein MmpL1 691 691 ctx cooccurence:691
Rv0283 eccB3 ESX-3 secretion system protein EccB3 690 691 ctx cooccurence:689
Rv1303 hyp hypothetical protein 684 684 ctx cooccurence:684
Rv1600 hisC1 histidinol-phosphate aminotransferase 673 673 ctx neighborhood:670
Rv1601 hisB imidazole glycerol-phosphate dehydratase 672 672 ctx neighborhood:670
Rv0756c hyp hypothetical protein 657 657 ctx cooccurence:653
Rv1599 hisD histidinol dehydrogenase 634 634 ctx neighborhood:631
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 633 633 ctx neighborhood:631
Rv2942 mmpL7 transmembrane transport protein MmpL7 606 606 ctx cooccurence:604
Rv1275 lprC lipoprotein LprC 595 595 ctx cooccurence:594

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: nitroreductase family deazaflavin-dependent oxidoreductase
  • Pfam (hmmscan --cut_ga): F420H2_quin_red PF04075.21 (E=4e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216114.1)
  • Domains: Pfam-A via hmmscan --cut_ga — F420H2_quin_red (PF04075.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C2H7
  • Curated reference: UniProt O06592 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor mmpL5
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001704|Rv1598c|
MSAKDHPNNAPGVPMVFPLWLERLQVKYINRALKPIARYLPGTATIEHRGRKSGKPYQTIVTAYRKDGVLAIALAHGKTDWVKNVLAAGEADVHFARGVVHVINPRIVPAGSDGQGLPRMARLQLRRIGVFVGDIA