hisB Resolved · high auto-curated

H37Rv Rv1601 · MTBC0 mtbc0_001707 · 210 aa · 1813999–1814631 MTBC0 (+) · RefSeq NP_216117.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand bioB (Rv1589) — requalified: biotin synthase BioB bioB Rv1590 (Rv1590) — family_assigned: hypothetical protein Rv1591 (Rv1591) — dark: DUF2567 domain-containing protein Rv1592c (Rv1592c) — family_assigned: lipase family protein Rv1592c Rv1593c (Rv1593c) — family_assigned: NUDIX domain-containing protein nadB (Rv1595) — requalified: L-aspartate oxidase nadB nadC (Rv1596) — requalified: carboxylating nicotinate-nucleotide diphosphorylase nadC Rv1597 (Rv1597) — family_assigned: methyltransferase domain-containing protein Rv1598c (Rv1598c) — family_assigned: nitroreductase family deazaflavin-dependent oxidoreductase hisD (Rv1599) — requalified: histidinol dehydrogenase hisD hisB (Rv1601) — requalified: imidazoleglycerol-phosphate dehydratase HisB hisH (Rv1602) — family_assigned: imidazole glycerol phosphate synthase subunit HisH hisA (Rv1603) — requalified: bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino) impA (Rv1604) — family_assigned: inositol monophosphatase family protein hisF (Rv1605) — family_assigned: imidazole glycerol phosphate synthase subunit HisF hisI (Rv1606) — requalified: phosphoribosyl-AMP cyclohydrolase chaA (Rv1607) — requalified: calcium:proton antiporter chaA bcpB (Rv1608c) — requalified: peroxiredoxin BcpB trpE (Rv1609) — requalified: anthranilate synthase component I trpE Rv1610 (Rv1610) — family_assigned: TIGR02234 family membrane protein trpC (Rv1611) — requalified: indole-3-glycerol phosphate synthase TrpC trpA (Rv1613) — family_assigned: tryptophan synthase subunit alpha lgt (Rv1614) — requalified: prolipoprotein diacylglyceryl transferase lgt 1 804 kb 1 808 kb 1 812 kb 1 816 kb 1 820 kb 1 824 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)imidazole glycerol-phosphate dehydratase
MTBC0 PGAP re-annotationimidazoleglycerol-phosphate dehydratase HisB
Revised (this work)Imidazoleglycerol-phosphate dehydratase HisB. Pfam: IGPD (PF00475.25).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).

PublicationDate
Structures of native, substrate-bound and inhibited forms of Mycobacterium tuberculosis imidazoleglycerol-phosphate dehydratase. doi:10.1107/S0907444913022579 2013
HisB from Mycobacterium tuberculosis: cloning, overexpression in Mycobacterium smegmatis, purification, crystallization and preliminary X-ray crystallographic analysis. doi:10.1107/S1744309111037201 2011
The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. doi:10.1046/j.1365-2958.2001.02684.x 2001

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene

NeighbourhisC (Rv1600, + strand)
Overlap4 bp, 1 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -8.48 (95% CI -9.76 to -7.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionHistidine biosynthesis (seventh step) [catalytic activity: D-erythro-1-(imidazol-4-YL)glycerol 3- phosphate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + H(2)O]
Mycobrowser EC 4.2.1.19 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1627 · 100.0% identity
M. leprae ML1259 · 84.8% identity
M. marinum MMAR_2397 · 89.0% identity
M. smegmatis MSMEG_3207 · 80.9% identity
M. orygis RJtmp_001673 · 100.0% identity
M. abscessus MAB_2668c · 85.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WML9 SwissProt · reviewed · Evidence at protein level
UniProt nameImidazoleglycerol-phosphate dehydratase
EC (curated) EC 4.2.1.19

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namehisB
eggNOG descriptionimidazoleglycerol-phosphate dehydratase
Orthologous groupCOG0131
EC number EC 3.1.3.15, EC 4.2.1.19
KEGG orthology K01089, K01693
KEGG pathways map00340, map01100, map01110, map01230
KEGG modules M00026
Gene Ontology (40) GO:0000105, GO:0003674, GO:0003824, GO:0004424, GO:0006082, GO:0006520, GO:0006547, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0008652 +28 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.115 (low power) · 4 consensus substitution(s)
low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 91.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.3%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 15 in the ORF — 15 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainRv1601-hisB-TetOn10.1 (TetON promoter 10)
Baseline knockdown fitness4.593 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance429.0 ppm · rank 468/3519 (86.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length210 aa
Molecular weight22.8 kDa
Theoretical pI6.34
GRAVY-0.236 (hydrophilic)
Aliphatic index88.3
Aromaticity0.048
Instability index38.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
IGPDPF00475.25 8.5e-5740–190 Imidazoleglycerol-phosphate dehydratase

Experimental structures (Protein Data Bank) 12 solved

PDBMethodResolutionCoverage
8wmp X-ray diffraction 1.75 Å 100%
5zqn X-ray diffraction 1.8 Å 100%
7fcy X-ray diffraction 1.848 Å 100%
5xds X-ray diffraction 1.75 Å 99%
4gqu X-ray diffraction 2.02 Å 99%
7ddv X-ray diffraction 2.2 Å 99%
9m2r Electron Microscopy 2.2 Å 99%
7dnq X-ray diffraction 2.28 Å 99%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (12 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4

PDB hitprobTM-scoreE-valueDescription
6khh-assembly1_A 1.00 0.99 2.3e-36 sig 6khh-assembly1_A Crystal Structure of HisB from Mycobacterium tuberculosis
6yjh-assembly1_A 1.00 0.99 4.4e-36 sig 6yjh-assembly1_A Crystal structure of Imidazole Glycerol Phosphate Dehydratase from Mycobacterium tuberculosis at 1.61 A resolution
8wmp-assembly1_A 1.00 0.99 3.1e-35 sig 8wmp-assembly1_A Crystal Structure of Mutant HisB from Mycobacterium tuberculosis
6fwh-assembly1_A 1.00 0.94 3.6e-26 sig 6fwh-assembly1_A Acanthamoeba IGPD in complex with R-C348 to 1.7A resolution
4mu4-assembly1_A 1.00 0.95 3.7e-25 sig 4mu4-assembly1_A The form B structure of an E21Q catalytic mutant of A. thaliana IGPD2 in complex with Mn2+ and its substrate, 2R3S-IGP, to 1.41 A resolution

Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 8

Upstream (5' on genome)hisC1 (+ strand, -4 bp gap)
Downstream (3' on genome)hisH (+ strand, -4 bp gap)
Predicted operon hisD · hisC1 · hisB · hisH · hisA · impA · hisF · hisI

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: hisH (imidazole glycerol phosphate synthase subunit HisH), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1602 hisH exp imidazole glycerol phosphate synthase subunit HisH 999 1000 ctx neighborhood:881 cooccurence:774 coexpression:958 database:900 textmining:617
Rv1599 hisD histidinol dehydrogenase 999 1000 ctx neighborhood:881 fusion:809 cooccurence:774 coexpression:957 textmining:938
Rv1605 hisF exp imidazole glycerol phosphate synthase subunit HisF 999 1000 ctx neighborhood:876 cooccurence:774 coexpression:884 database:900 textmining:697
Rv1600 hisC1 exp histidinol-phosphate aminotransferase 999 1000 ctx neighborhood:882 fusion:851 cooccurence:729 coexpression:937 database:900 textmining:711
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 999 999 ctx neighborhood:876 cooccurence:770 coexpression:967 textmining:822
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 999 997 ctx neighborhood:876 cooccurence:774 coexpression:887 textmining:759
Rv3772 hisC2 exp histidinol-phosphate aminotransferase 997 997 ctx fusion:860 coexpression:692 database:900
Rv2231c cobC exp aminotransferase 979 977 coexpression:693 database:900
Rv1604 impA inositol-monophosphatase ImpA 973 970 ctx neighborhood:876 coexpression:770
Rv2121c hisG ATP phosphoribosyltransferase 994 969 ctx cooccurence:764 coexpression:857 textmining:843
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 981 885 coexpression:857 textmining:848
Rv1598c hyp hypothetical protein 672 672 ctx neighborhood:670
Rv3859c gltB glutamate synthase large subunit 735 639 ctx neighborhood:448
Rv2483c plsC bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase 579 513 coexpression:468
Rv3661 hyp hypothetical protein 526 488 coexpression:471

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: imidazole glycerol-phosphate dehydratase
  • MTBC0 PGAP product: imidazoleglycerol-phosphate dehydratase HisB
  • Pfam (hmmscan --cut_ga): IGPD PF00475.25 (E=8e-57)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216117.1)
  • Domains: Pfam-A via hmmscan --cut_ga — IGPD (PF00475.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0131
  • Curated reference: UniProt P9WML9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 53 functional partner(s); context anchor hisH
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001707|Rv1601|hisB
MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL