hisB Resolved · high auto-curated
H37Rv Rv1601 · MTBC0 mtbc0_001707 ·
210 aa ·
1813999–1814631 MTBC0
(+) ·
RefSeq NP_216117.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | imidazole glycerol-phosphate dehydratase |
|---|---|
| MTBC0 PGAP re-annotation | imidazoleglycerol-phosphate dehydratase HisB |
| Revised (this work) | Imidazoleglycerol-phosphate dehydratase HisB. Pfam: IGPD (PF00475.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).
| Publication | Date |
|---|---|
| Structures of native, substrate-bound and inhibited forms of Mycobacterium tuberculosis imidazoleglycerol-phosphate dehydratase. doi:10.1107/S0907444913022579 | 2013 |
| HisB from Mycobacterium tuberculosis: cloning, overexpression in Mycobacterium smegmatis, purification, crystallization and preliminary X-ray crystallographic analysis. doi:10.1107/S1744309111037201 | 2011 |
| The Mycobacterium tuberculosis IdeR is a dual functional regulator that controls transcription of genes involved in iron acquisition, iron storage and survival in macrophages. doi:10.1046/j.1365-2958.2001.02684.x | 2001 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | hisC (Rv1600, + strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -8.48 (95% CI -9.76 to -7.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Histidine biosynthesis (seventh step) [catalytic activity: D-erythro-1-(imidazol-4-YL)glycerol 3- phosphate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + H(2)O] |
|---|---|
| Mycobrowser EC |
4.2.1.19
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1627
· 100.0% identity |
|---|---|
| M. leprae |
ML1259
· 84.8% identity |
| M. marinum |
MMAR_2397
· 89.0% identity |
| M. smegmatis |
MSMEG_3207
· 80.9% identity |
| M. orygis |
RJtmp_001673
· 100.0% identity |
| M. abscessus |
MAB_2668c
· 85.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WML9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Imidazoleglycerol-phosphate dehydratase |
| EC (curated) |
EC 4.2.1.19
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | hisB |
| eggNOG description | imidazoleglycerol-phosphate dehydratase |
| Orthologous group | COG0131 |
| EC number |
EC 3.1.3.15, EC 4.2.1.19
|
| KEGG orthology |
K01089, K01693
|
| KEGG pathways |
map00340, map01100, map01110, map01230
|
| KEGG modules |
M00026
|
| Gene Ontology (40) |
GO:0000105, GO:0003674, GO:0003824, GO:0004424, GO:0006082, GO:0006520, GO:0006547, GO:0006725, GO:0006807, GO:0008150, GO:0008152, GO:0008652 +28 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.115 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 91.6%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 66.3% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 15 in the ORF — 15 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1601-hisB-TetOn10.1 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 4.593 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 429.0 ppm · rank 468/3519 (86.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 210 aa |
|---|---|
| Molecular weight | 22.8 kDa |
| Theoretical pI | 6.34 |
| GRAVY | -0.236 (hydrophilic) |
| Aliphatic index | 88.3 |
| Aromaticity | 0.048 |
| Instability index | 38.2 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
IGPD | PF00475.25 | 8.5e-57 | 40–190 | Imidazoleglycerol-phosphate dehydratase |
Experimental structures (Protein Data Bank) 12 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
8wmp |
X-ray diffraction | 1.75 Å | 100% |
5zqn |
X-ray diffraction | 1.8 Å | 100% |
7fcy |
X-ray diffraction | 1.848 Å | 100% |
5xds |
X-ray diffraction | 1.75 Å | 99% |
4gqu |
X-ray diffraction | 2.02 Å | 99% |
7ddv |
X-ray diffraction | 2.2 Å | 99% |
9m2r |
Electron Microscopy | 2.2 Å | 99% |
7dnq |
X-ray diffraction | 2.28 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (12 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6khh-assembly1_A |
1.00 | 0.99 | 2.3e-36 sig | 6khh-assembly1_A Crystal Structure of HisB from Mycobacterium tuberculosis |
6yjh-assembly1_A |
1.00 | 0.99 | 4.4e-36 sig | 6yjh-assembly1_A Crystal structure of Imidazole Glycerol Phosphate Dehydratase from Mycobacterium tuberculosis at 1.61 A resolution |
8wmp-assembly1_A |
1.00 | 0.99 | 3.1e-35 sig | 8wmp-assembly1_A Crystal Structure of Mutant HisB from Mycobacterium tuberculosis |
6fwh-assembly1_A |
1.00 | 0.94 | 3.6e-26 sig | 6fwh-assembly1_A Acanthamoeba IGPD in complex with R-C348 to 1.7A resolution |
4mu4-assembly1_A |
1.00 | 0.95 | 3.7e-25 sig | 4mu4-assembly1_A The form B structure of an E21Q catalytic mutant of A. thaliana IGPD2 in complex with Mn2+ and its substrate, 2R3S-IGP, to 1.41 A resolution |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 8
| Upstream (5' on genome) | hisC1 (+ strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | hisH (+ strand, -4 bp gap) |
| Predicted operon |
hisD · hisC1 · hisB · hisH · hisA · impA · hisF · hisI
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hisH (imidazole glycerol phosphate synthase subunit HisH), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1602 hisH exp |
imidazole glycerol phosphate synthase subunit HisH | 999 | 1000 ctx | neighborhood:881 cooccurence:774 coexpression:958 database:900 textmining:617 |
Rv1599 hisD |
histidinol dehydrogenase | 999 | 1000 ctx | neighborhood:881 fusion:809 cooccurence:774 coexpression:957 textmining:938 |
Rv1605 hisF exp |
imidazole glycerol phosphate synthase subunit HisF | 999 | 1000 ctx | neighborhood:876 cooccurence:774 coexpression:884 database:900 textmining:697 |
Rv1600 hisC1 exp |
histidinol-phosphate aminotransferase | 999 | 1000 ctx | neighborhood:882 fusion:851 cooccurence:729 coexpression:937 database:900 textmining:711 |
Rv1603 hisA |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 999 | 999 ctx | neighborhood:876 cooccurence:770 coexpression:967 textmining:822 |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 999 | 997 ctx | neighborhood:876 cooccurence:774 coexpression:887 textmining:759 |
Rv3772 hisC2 exp |
histidinol-phosphate aminotransferase | 997 | 997 ctx | fusion:860 coexpression:692 database:900 |
Rv2231c cobC exp |
aminotransferase | 979 | 977 | coexpression:693 database:900 |
Rv1604 impA |
inositol-monophosphatase ImpA | 973 | 970 ctx | neighborhood:876 coexpression:770 |
Rv2121c hisG |
ATP phosphoribosyltransferase | 994 | 969 ctx | cooccurence:764 coexpression:857 textmining:843 |
Rv2122c hisE |
phosphoribosyl-ATP pyrophosphatase | 981 | 885 | coexpression:857 textmining:848 |
Rv1598c hyp |
hypothetical protein | 672 | 672 ctx | neighborhood:670 |
Rv3859c gltB |
glutamate synthase large subunit | 735 | 639 ctx | neighborhood:448 |
Rv2483c plsC |
bifunctional L-3-phosphoserine phosphatase/1-acyl-sn-glycerol-3-phosphate acyltransferase | 579 | 513 | coexpression:468 |
Rv3661 hyp |
hypothetical protein | 526 | 488 | coexpression:471 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: imidazole glycerol-phosphate dehydratase
- MTBC0 PGAP product: imidazoleglycerol-phosphate dehydratase HisB
- Pfam (hmmscan --cut_ga): IGPD PF00475.25 (E=8e-57)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216117.1)
- Domains: Pfam-A via hmmscan --cut_ga — IGPD (PF00475.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0131 - Curated reference: UniProt P9WML9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
53 functional partner(s); context anchor
hisH - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001707|Rv1601|hisB MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDLTVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSGRPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITEAQYKAVARALRQAVEPDPRVSGVPSTKGAL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hisB? Email the maintainer — the message is pre-filled with this gene's details.