impA Family assigned · medium auto-curated

H37Rv Rv1604 · MTBC0 mtbc0_001710 · 270 aa · 1816003–1816815 (+) · RefSeq NP_216120.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)inositol-monophosphatase ImpA
MTBC0 PGAP re-annotationinositol monophosphatase family protein
Revised (this work)Inositol monophosphatase family protein. Pfam: Inositol_P (PF00459.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53907 SwissProt · reviewed · Evidence at transcript level
UniProt nameProbable inositol 1-monophosphatase ImpA
EC (curated) EC 3.1.3.25
Curated functionCatalyzes the dephosphorylation of inositol 1-phosphate (I-1-P) to yield free myo-inositol, a key metabolite in mycobacteria.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred nameimpA
eggNOG descriptionInositol monophosphatase
Orthologous groupCOG0483
EC number EC 3.1.3.25
KEGG orthology K01092
KEGG pathways map00521, map00562, map01100, map04070
KEGG modules M00131
Gene Ontology (61) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0005975, GO:0006020, GO:0006021, GO:0006066, GO:0006793, GO:0006796, GO:0007154 +49 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.647 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Inositol_PPF00459.31 1.7e-5718–261 Inositol monophosphatase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hisF (imidazole glycerol phosphate synthase subunit HisF), high confidence from genomic context alone (score 983 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 998 983 ctx neighborhood:881 coexpression:865 textmining:921
Rv1603 hisA 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 997 983 ctx neighborhood:882 coexpression:860 textmining:879
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 978 977 ctx neighborhood:881 coexpression:817
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 975 974 ctx neighborhood:876 coexpression:801
Rv1601 hisB imidazole glycerol-phosphate dehydratase 973 970 ctx neighborhood:876 coexpression:770
Rv2701c suhB inositol-1-monophosphatase SuhB 939 929 database:900
Rv0046c ino1 inositol-3-phosphate synthase 983 908 database:900 textmining:827
Rv1600 hisC1 histidinol-phosphate aminotransferase 913 908 ctx neighborhood:876
Rv1599 hisD histidinol dehydrogenase 928 902 ctx neighborhood:876
Rv2349c plcC phospholipase C 900 901 database:900
Rv1755c plcD Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o 900 901 database:900
Rv2350c plcB membrane-associated phospholipase B 900 900 database:900
Rv2351c plcA membrane-associated phospholipase A 900 900 database:900
Rv3608c folP1 dihydropteroate synthase 744 745 coexpression:736
Rv2841c nusA transcription termination/antitermination protein NusA 570 568 experimental:484

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: inositol-monophosphatase ImpA
  • MTBC0 PGAP product: inositol monophosphatase family protein
  • Pfam (hmmscan --cut_ga): Inositol_P PF00459.31 (E=2e-57)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216120.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Inositol_P (PF00459.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0483
  • Curated reference: UniProt O53907 (SwissProt, reviewed; Evidence at transcript level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor hisF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001710|Rv1604|impA
MHLDSLVAPLVEQASAILDAATALFLVGHRADSAVRKKGNDFATEVDLAIERQVVAALVAATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLAAILLGLLHDGVPVAGLTWMPFTDQRYTAVAGGPLIKNGVPQPPLADAELANVLVGVGTFSADSRGQFPGRYRLAVLEKLSRVSSRLRMHGSTGIDLVFVADGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWTPASRSALAGPPRVHAQILEILGSIGEPEDY