impA Family assigned · medium auto-curated
H37Rv Rv1604 · MTBC0 mtbc0_001710 ·
270 aa ·
1816003–1816815 MTBC0
(+) ·
RefSeq NP_216120.1
Non-canonical microproteins (overlapping smORFs)
1 MS-proven microprotein from the separate microproteome track overlap this locus (existence proven, function unknown; not counted among the canonical genes).
| Microprotein | Relationship | Length | Essentiality |
|---|---|---|---|
| gORF_74745 | same-strand overlap (alternative frame) | 93 aa | — |
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | inositol-monophosphatase ImpA |
|---|---|
| MTBC0 PGAP re-annotation | inositol monophosphatase family protein |
| Revised (this work) | Inositol monophosphatase family protein. Pfam: Inositol_P (PF00459.31). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) studied as much outside M. tuberculosis
The biology of this gene is documented at least as much outside M. tuberculosis as within it — 3 paper(s) in a non-TB mycobacterial context (M. smegmatis 3) versus 2 in a TB context. Mycobacterial genetics is largely done in M. smegmatis, so part of what is “known” about this gene is known by proxy.
- Inositol Monophosphatase: A Bifunctional Enzyme in Mycobacterium smegmatis. (2018)
- Inositol monophosphate phosphatase genes of Mycobacterium tuberculosis. (2010)
- A Mycobacterium smegmatis mutant with a defective inositol monophosphate phosphatase gene homolog has altered cell envelope permeability. (1997)
Caveat: IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge.
7 TB publications mention this gene. 7 publication(s) discuss this gene. **Its biology is documented at least as much OUTSIDE M. tuberculosis as within it** (3 papers in a non-TB mycobacterial context — M. smegmatis (3) — vs 2 in a TB context). Mycobacterial genetics is largely done in M. smegmatis, so part of what is 'known' about this gene is known by proxy.
| Publication | Date |
|---|---|
| Evaluation of the potential virulence of Mycobacterium avium subspecies paratuberculosis isolates from cattle in Uganda. doi:10.1007/s42770-026-01951-7 | 2026 |
| Cross-species virulence strategies of Mycobacterium avium subsp. paratuberculosis: Gene expression and infection progression in sheep and guanacos. doi:10.1016/j.actatropica.2025.107853 | 2025 |
| Inositol Monophosphatase: A Bifunctional Enzyme in Mycobacterium smegmatis. doi:10.1021/acsomega.8b01753 | 2018 |
| Partial proteome of Mycobacterium avium subsp. paratuberculosis under oxidative and nitrosative stress. doi:10.1016/j.vetmic.2010.03.025 | 2010 |
| Inositol monophosphate phosphatase genes of Mycobacterium tuberculosis. doi:10.1186/1471-2180-10-50 | 2010 |
IMPORTANT — 'better studied elsewhere' does NOT mean 'function established in M. tuberculosis'. Findings obtained in M. smegmatis (a non-pathogenic, fast-growing species with a different lifestyle and regulation), or in M. marinum / M. leprae / M. abscessus, do NOT transfer automatically to M. tuberculosis. Treat this body of work as CONTEXT to verify, not as settled knowledge. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -7.50 (95% CI -13.26 to -0.79). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in inositol phosphate metabolism. It is responsible for the provision of inositol required for synthesis of phosphatidylinositol and polyphosphoinositides. Key enzyme of the phosphatidyl inositol signaling pathway [catalytic activity: inositol 1(or 4)-monophosphate + H(2)O = inositol + orthophosphate]. |
|---|---|
| Mycobrowser EC |
3.1.3.25
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1630
· 98.9% identity |
|---|---|
| M. marinum |
MMAR_2400
· 78.1% identity |
| M. smegmatis |
MSMEG_3210
· 70.5% identity |
| M. orygis |
RJtmp_001676
· 99.6% identity |
| M. abscessus |
MAB_2665c
· 68.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O53907
SwissProt · reviewed
· Evidence at transcript level
|
|---|---|
| UniProt name | Probable inositol 1-monophosphatase ImpA |
| EC (curated) |
EC 3.1.3.25
|
| Curated function | Catalyzes the dephosphorylation of inositol 1-phosphate (I-1-P) to yield free myo-inositol, a key metabolite in mycobacteria. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
G Carbohydrate transport and metabolism
|
|---|---|
| Preferred name | impA |
| eggNOG description | Inositol monophosphatase |
| Orthologous group | COG0483 |
| EC number |
EC 3.1.3.25
|
| KEGG orthology |
K01092
|
| KEGG pathways |
map00521, map00562, map01100, map04070
|
| KEGG modules |
M00131
|
| Gene Ontology (61) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0005975, GO:0006020, GO:0006021, GO:0006066, GO:0006793, GO:0006796, GO:0007154 +49 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.647 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 7 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.109
· 29 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.109) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 52/53 (98%) · mean identity 77.4%
· 3/4 closest MTBAP relatives conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 49.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 13 in the ORF — 0 in the essential state, 0 growth-defect, 13 non-essential, 0 growth-advantage. Saturation 0.923, mean read count 59.4166666667. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 13.8 ppm · rank 2530/3519 (28.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 270 aa |
|---|---|
| Molecular weight | 28.0 kDa |
| Theoretical pI | 5.16 |
| GRAVY | 0.311 (hydrophobic) |
| Aliphatic index | 107.7 |
| Aromaticity | 0.063 |
| Instability index | 41.7 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Inositol_P | PF00459.31 | 1.7e-57 | 18–261 | Inositol monophosphatase family |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8wip-assembly1_B |
1.00 | 0.89 | 2.3e-19 sig | 8wip-assembly1_B Crystal Structure of Pseudomonas aeruginosa SuhB in its apo form. |
3luz-assembly1_A |
1.00 | 0.87 | 8.7e-19 sig | 3luz-assembly1_A Crystal structure of extragenic suppressor protein suhB from Bartonella henselae, via combined iodide SAD molecular replacement |
5zhh-assembly1_A |
1.00 | 0.88 | 3.0e-18 sig | 5zhh-assembly1_A Structure of Inositol monophosphatase from Anabaena (Nostoc) sp. PCC 7120 |
3t0j-assembly1_A |
1.00 | 0.83 | 1.3e-18 sig | 3t0j-assembly1_A Crystal structure of inositol monophosphatase - II from Staphylococcus aureus MSSA476 |
3luz-assembly1_B |
1.00 | 0.87 | 3.9e-18 sig | 3luz-assembly1_B Crystal structure of extragenic suppressor protein suhB from Bartonella henselae, via combined iodide SAD molecular replacement |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 8
| Upstream (5' on genome) | hisA (+ strand, 7 bp gap) |
|---|---|
| Downstream (3' on genome) | hisF (+ strand, 1 bp gap) |
| Predicted operon |
hisD · hisC1 · hisB · hisH · hisA · impA · hisF · hisI
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hisF (imidazole glycerol phosphate synthase subunit HisF), high confidence from genomic context alone (score 983 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1605 hisF |
imidazole glycerol phosphate synthase subunit HisF | 998 | 983 ctx | neighborhood:881 coexpression:865 textmining:921 |
Rv1603 hisA |
1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase | 997 | 983 ctx | neighborhood:882 coexpression:860 textmining:879 |
Rv1606 hisI |
phosphoribosyl-AMP cyclohydrolase | 978 | 977 ctx | neighborhood:881 coexpression:817 |
Rv1602 hisH |
imidazole glycerol phosphate synthase subunit HisH | 975 | 974 ctx | neighborhood:876 coexpression:801 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 973 | 970 ctx | neighborhood:876 coexpression:770 |
Rv2701c suhB exp |
inositol-1-monophosphatase SuhB | 939 | 929 | database:900 |
Rv0046c ino1 exp |
inositol-3-phosphate synthase | 983 | 908 | database:900 textmining:827 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 913 | 908 ctx | neighborhood:876 |
Rv1599 hisD |
histidinol dehydrogenase | 928 | 902 ctx | neighborhood:876 |
Rv2349c plcC exp |
phospholipase C | 900 | 901 | database:900 |
Rv1755c plcD exp |
Rv1755c, (MT1799, MTCY28.21c), len: 280 aa. Probable plcD, phospholipase C 4 (fragment) (see citations below),highly similar to C-terminus o | 900 | 901 | database:900 |
Rv2350c plcB exp |
membrane-associated phospholipase B | 900 | 900 | database:900 |
Rv2351c plcA exp |
membrane-associated phospholipase A | 900 | 900 | database:900 |
Rv3608c folP1 |
dihydropteroate synthase | 744 | 745 | coexpression:736 |
Rv2841c nusA exp |
transcription termination/antitermination protein NusA | 570 | 568 | experimental:484 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: inositol-monophosphatase ImpA
- MTBC0 PGAP product: inositol monophosphatase family protein
- Pfam (hmmscan --cut_ga): Inositol_P PF00459.31 (E=2e-57)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216120.1)
- Domains: Pfam-A via hmmscan --cut_ga — Inositol_P (PF00459.31)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0483 - Curated reference: UniProt O53907 (SwissProt, reviewed; Evidence at transcript level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
hisF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001710|Rv1604|impA MHLDSLVAPLVEQASAILDAATALFLVGHRADSAVRKKGNDFATEVDLAIERQVVAALVAATGIEVHGEEFGGPAVDSRWVWVLDPIDGTINYAAGSPLAAILLGLLHDGVPVAGLTWMPFTDQRYTAVAGGPLIKNGVPQPPLADAELANVLVGVGTFSADSRGQFPGRYRLAVLEKLSRVSSRLRMHGSTGIDLVFVADGILGGAISFGGHVWDHAAGVALVRAAGGVVTDLAGQPWTPASRSALAGPPRVHAQILEILGSIGEPEDY
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for impA? Email the maintainer — the message is pre-filled with this gene's details.