nadB Resolved · high auto-curated
H37Rv Rv1595 · MTBC0 mtbc0_001701 ·
527 aa ·
1807769–1809352 MTBC0
(+) ·
RefSeq NP_216111.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | L-aspartate oxidase |
|---|---|
| MTBC0 PGAP re-annotation | L-aspartate oxidase |
| Revised (this work) | L-aspartate oxidase. Pfam: FAD_binding_2 (PF00890.31), Succ_DH_flav_C (PF02910.26). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context).
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | nadA (Rv1594, + strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -6.92 (95% CI -7.51 to -6.32). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Quinolinate biosynthesis. Catalyzes the oxidation of L-aspartate to iminoaspartate which is condensed with dihydroxyacetone phosphate to quinolinate under the action of quinolinate synthase a [catalytic activity: L-aspartate + H(2)O + O(2) = oxaloacetate + NH(3) + H(2)O(2)] |
|---|---|
| Mycobrowser EC |
1.4.3.16
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1621
· 100.0% identity |
|---|---|
| M. leprae |
ML1226
· 76.7% identity |
| M. marinum |
MMAR_2392
· 80.3% identity |
| M. smegmatis |
MSMEG_3200
· 69.5% identity |
| M. orygis |
RJtmp_001667
· 99.8% identity |
| M. abscessus |
MAB_2673c
· 66.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJJ9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | L-aspartate oxidase |
| EC (curated) |
EC 1.4.3.16
|
| Curated function | Catalyzes the oxidation of L-aspartate to iminoaspartate, the first step in the de novo biosynthesis of NAD(+). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | nadB |
| eggNOG description | Catalyzes the oxidation of L-aspartate to iminoaspartate |
| Orthologous group | COG0029 |
| EC number |
EC 1.4.3.16
|
| KEGG orthology |
K00278
|
| KEGG pathways |
map00250, map00760, map01100
|
| KEGG modules |
M00115
|
| Gene Ontology (2) |
GO:0008150, GO:0040007
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.744 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 10 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.124
· 9 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.124) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 78.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 11/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 47.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 24 in the ORF — 24 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.083, mean read count 1.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1595-nadB-TetOn18.1 (TetON promoter 18) |
|---|---|
| Baseline knockdown fitness | 2.814 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) | +4.23 | 0.037 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 50.7 ppm · rank 1740/3519 (50.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 527 aa |
|---|---|
| Molecular weight | 53.8 kDa |
| Theoretical pI | 6.24 |
| GRAVY | 0.166 (hydrophobic) |
| Aliphatic index | 95.5 |
| Aromaticity | 0.04 |
| Instability index | 30.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FAD_binding_2 | PF00890.31 | 3.1e-88 | 11–381 | FAD binding domain |
Succ_DH_flav_C | PF02910.26 | 1.6e-06 | 426–498 | Fumarate reductase flavoprotein C-term |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1knr-assembly1_A |
1.00 | 0.87 | 1.8e-48 sig | 1knr-assembly1_A L-aspartate oxidase: R386L mutant |
6awf-assembly1_A |
1.00 | 0.89 | 1.5e-48 sig | 6awf-assembly1_A Escherichia coli quinol:fumarate reductase crystallized without dicarboxylate |
5vpn-assembly2_E |
1.00 | 0.88 | 1.5e-46 sig | 5vpn-assembly2_E E. coli Quinol fumarate reductase FrdA E245Q mutation |
5c3j-assembly2_E |
1.00 | 0.90 | 4.0e-45 sig | 5c3j-assembly2_E Crystal structure of Mitochondrial rhodoquinol-fumarate reductase from Ascaris suum with Ubiquinone-1 |
2e5v-assembly2_B |
1.00 | 0.85 | 3.4e-45 sig | 2e5v-assembly2_B Crystal structure of L-Aspartate Oxidase from hyperthermophilic archaeon Sulfolobus tokodaii |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | nadA (+ strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | nadC (+ strand, -1 bp gap) |
| Predicted operon |
nadA · nadB · nadC · Rv1597
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: nadA (quinolinate synthetase A), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1594 nadA exp |
quinolinate synthetase A | 999 | 1000 ctx | neighborhood:881 cooccurence:769 coexpression:966 experimental:446 database:900 textmining:944 |
Rv1596 nadC |
nicotinate-nucleotide pyrophosphatase | 999 | 1000 ctx | neighborhood:881 fusion:869 cooccurence:767 coexpression:947 textmining:965 |
Rv1538c ansA exp |
L-aparaginase | 918 | 905 | database:900 |
Rv1380 pyrB exp |
aspartate carbamoyltransferase | 909 | 902 | database:900 |
Rv0357c purA exp |
adenylosuccinate synthetase | 913 | 901 | database:900 |
Rv1658 argG exp |
argininosuccinate synthase | 913 | 901 | database:900 |
Rv2201 asnB exp |
asparagine synthetase | 903 | 900 | database:900 |
Rv3601c panD exp |
aspartate 1-decarboxylase | 845 | 830 | database:800 |
Rv1593c hyp |
hypothetical protein | 832 | 825 ctx | neighborhood:788 |
Rv3709c ask exp |
aspartokinase | 824 | 815 | database:800 |
Rv2455c korA exp |
2-oxoglutarate oxidoreductase subunit KorA | 826 | 812 | database:800 |
Rv0066c icd2 exp |
isocitrate dehydrogenase | 809 | 809 | database:800 |
Rv1240 mdh exp |
malate dehydrogenase | 835 | 808 | database:800 |
Rv0211 pckA exp |
phosphoenolpyruvate carboxykinase | 817 | 807 | database:800 |
Rv3432c gadB exp |
glutamate decarboxylase GadB | 806 | 806 | database:800 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: L-aspartate oxidase
- MTBC0 PGAP product: L-aspartate oxidase
- Pfam (hmmscan --cut_ga): FAD_binding_2 PF00890.31 (E=3e-88), Succ_DH_flav_C PF02910.26 (E=2e-06)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216111.1)
- Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_2 (PF00890.31), Succ_DH_flav_C (PF02910.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0029 - Curated reference: UniProt P9WJJ9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
42 functional partner(s); context anchor
nadA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001701|Rv1595|nadB MAGPAWRDAADVVVIGTGVAGLAAALAADRAGRSVVVLSKAAQTHVTATHYAQGGIAVVLPDNDDSVDAHVADTLAAGAGLCDPDAVYSIVADGYRAVTDLVGAGARLDESVPGRWALTREGGHSRRRIVHAGGDATGAEVQRALQDAAGMLDIRTGHVALRVLHDGTAVTGLLVVRPDGCGIISAPSVILATGGLGHLYSATTNPAGSTGDGIALGLWAGVAVSDLEFIQFHPTMLFAGRAGGRRPLITEAIRGEGAILVDRQGNSITAGVHPMGDLAPRDVVAAAIDARLKATGDPCVYLDARGIEGFASRFPTVTASCRAAGIDPVRQPIPVVPGAHYSCGGIVTDVYGQTELLGLYAAGEVARTGLHGANRLASNSLLEGLVVGGRAGKAAAAHAAAAGRSRATSSATWPEPISYTALDRGDLQRAMSRDASMYRAAAGLHRLCDSLSGAQVRDVACRRDFEDVALTLVAQSVTAAALARTESRGCHHRAEYPCTVPEQARSIVVRGADDANAVCVQALVAVC
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nadB? Email the maintainer — the message is pre-filled with this gene's details.