Rv1590 Family assigned · medium auto-curated
H37Rv Rv1590 · MTBC0 mtbc0_001696 ·
79 aa · 1803298–1803537 (+) ·
RefSeq NP_216106.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Contains BsaP (PF26519.1) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLT7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Biotin synthase auxiliary protein |
| Curated function | Required for the activity of the biotin synthase BioB. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2EH0W |
|---|---|
| Gene Ontology (33) |
GO:0002682, GO:0002684, GO:0008150, GO:0009605, GO:0009607, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419, GO:0048518, GO:0048583 +21 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BsaP | PF26519.1 | 5.7e-17 | 51–79 | Biotin synthase auxiliary protein family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: bioB (biotin synthetase), high confidence from genomic context alone (score 956 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1589 bioB |
biotin synthetase | 959 | 956 ctx | neighborhood:881 cooccurence:556 |
Rv1591 |
transmembrane protein | 887 | 887 ctx | neighborhood:881 |
Rv1343c lprD |
lipoprotein LprD | 663 | 663 ctx | cooccurence:662 |
Rv2001 hyp |
hypothetical protein | 550 | 551 ctx | cooccurence:548 |
Rv2418c octT hyp |
hypothetical protein | 519 | 520 ctx | cooccurence:508 |
Rv2609c |
membrane protein | 504 | 505 ctx | cooccurence:493 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 502 | 503 ctx | cooccurence:496 |
Rv1570 bioD |
ATP-dependent dethiobiotin synthetase BioD | 521 | 500 | |
Rv1683 |
bifunctional long-chain acyl-CoA synthase/lipase | 494 | 495 ctx | cooccurence:480 |
Rv3805c aftB |
terminal beta-(1->2)-arabinofuranosyltransferase | 482 | 482 ctx | cooccurence:479 |
Rv0464c hyp |
hypothetical protein | 481 | 482 ctx | cooccurence:477 |
Rv3755c hyp |
hypothetical protein | 479 | 480 ctx | cooccurence:478 |
Rv0876c |
transmembrane protein | 460 | 461 ctx | cooccurence:459 |
Rv3802c |
membrane protein | 430 | 431 ctx | cooccurence:428 |
Rv2739c |
transferase | 430 | 431 ctx | cooccurence:424 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: hypothetical protein
- Pfam (hmmscan --cut_ga): BsaP PF26519.1 (E=6e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216106.1)
- Domains: Pfam-A via hmmscan --cut_ga — BsaP (PF26519.1)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EH0W - Curated reference: UniProt P9WLT7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
bioB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001696|Rv1590| MVEIVAGKQRAPVAAGVYNVYTGELADTATPTAARMGLEPPRFCAQCGRRMVVQVRPDGWWARCSRHGQVDSADLATQR