bioB Resolved · high auto-curated

H37Rv Rv1589 · MTBC0 mtbc0_001695 · 349 aa · 1802248–1803297 (+) · RefSeq NP_216105.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)biotin synthetase
MTBC0 PGAP re-annotationbiotin synthase BioB
Revised (this work)Biotin synthase BioB. Pfam: Radical_SAM (PF04055.28), BATS (PF06968.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WPQ7 SwissProt · reviewed · Evidence at protein level
UniProt nameBiotin synthase
EC (curated) EC 2.8.1.6
Curated functionCatalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namebioB
eggNOG descriptionCatalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical- based mechanism
Orthologous groupCOG0502
EC number EC 2.8.1.6
KEGG orthology K01012
KEGG pathways map00780, map01100
KEGG modules M00123, M00573, M00577
Gene Ontology (8) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.515 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Radical_SAMPF04055.28 2.6e-2082–239 Radical SAM superfamily
BATSPF06968.19 1.7e-19250–339 Biotin and Thiamin Synthesis associated domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bioD (ATP-dependent dethiobiotin synthetase BioD), high confidence from genomic context alone (score 997 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1570 bioD ATP-dependent dethiobiotin synthetase BioD 999 997 ctx cooccurence:770 coexpression:856 database:900 textmining:954
Rv1568 bioA adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA 999 976 ctx fusion:633 cooccurence:756 coexpression:693 textmining:963
Rv1590 hyp hypothetical protein 959 956 ctx neighborhood:881 cooccurence:556
Rv3279c birA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase 985 912 database:900 textmining:840
Rv1569 bioF1 8-amino-7-oxononanoate synthase 990 910 ctx cooccurence:629 coexpression:672 textmining:902
Rv1591 transmembrane protein 906 906 ctx neighborhood:881
Rv1442 bisC biotin sulfoxide reductase BisC 900 900 database:900
Rv0032 bioF2 8-amino-7-oxononanoate synthase 923 810 coexpression:669 textmining:613
Rv3329 aminotransferase 764 733 coexpression:693
Rv0423c thiC phosphomethylpyrimidine synthase 641 507
Rv1596 nadC nicotinate-nucleotide pyrophosphatase 481 448
Rv1594 nadA quinolinate synthetase A 537 447 coexpression:415
Rv2213 pepB cytosol aminopeptidase 464 386
Rv1571 hyp hypothetical protein 485 342
Rv2524c fas fatty acid synthase 532 245 textmining:406

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: biotin synthetase
  • MTBC0 PGAP product: biotin synthase BioB
  • Pfam (hmmscan --cut_ga): Radical_SAM PF04055.28 (E=3e-20), BATS PF06968.19 (E=2e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216105.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Radical_SAM (PF04055.28), BATS (PF06968.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0502
  • Curated reference: UniProt P9WPQ7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s); context anchor bioD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001695|Rv1589|bioB
MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVLAVLQLPDDRLEELLALAHEVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDIPSLVEAAKQTAKSGATEFCIVAAVRGPDERLMAQVAAGIEAIRNEVEINIACSLGMLTAEQVDQLAARGVHRYNHNLETARSFFANVVTTHTWEERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELGPDEVPLNFLNPRPGTPFADLEVMPVGDALKAVAAFRLALPRTMLRFAGGREITLGDLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLDELQMPLKALNASL