bioB Resolved · high auto-curated
H37Rv Rv1589 · MTBC0 mtbc0_001695 ·
349 aa ·
1802248–1803297 MTBC0
(+) ·
RefSeq NP_216105.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | biotin synthetase |
|---|---|
| MTBC0 PGAP re-annotation | biotin synthase BioB |
| Revised (this work) | Biotin synthase BioB. Pfam: Radical_SAM (PF04055.28), BATS (PF06968.19). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 7 publications
7 TB publications mention this gene. 7 publication(s) discuss this gene (6 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (4), M. leprae (1)).
| Publication | Date |
|---|---|
| Screening of bioactive compounds from selected mushroom species against putative drug targets in Mycobacterium tuberculosis: a multi-target approach. doi:10.1080/07391102.2024.2335292 | 2025 |
| Mycobacterial biotin synthases require an auxiliary protein to convert dethiobiotin into biotin. doi:10.1038/s41467-024-48448-1 | 2024 |
| Identification of genes associated with persistence in Mycobacterium smegmatis. doi:10.3389/fmicb.2024.1302883 | 2024 |
| Mycobacterium leprae and host immune transcriptomic signatures for reactional states in leprosy. doi:10.3389/fmicb.2023.1113318 | 2023 |
| Investigation of ( S)-(-)-Acidomycin: A Selective Antimycobacterial Natural Product That Inhibits Biotin Synthase. doi:10.1021/acsinfecdis.8b00345 | 2019 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
1 reported modified residue(s):
N-acetylthreonine @2.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -0.17 (95% CI -0.28 to -0.05). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in biotin synthesis. |
|---|---|
| Mycobrowser EC |
2.8.1.6
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1615
· 99.7% identity |
|---|---|
| M. leprae |
ML1220
· 87.1% identity |
| M. marinum |
MMAR_2387
· 90.8% identity |
| M. smegmatis |
MSMEG_3194
· 86.7% identity |
| M. orygis |
RJtmp_001661
· 99.4% identity |
| M. abscessus |
MAB_2684c
· 86.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WPQ7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Biotin synthase |
| EC (curated) |
EC 2.8.1.6
|
| Curated function | Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical-based mechanism. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | bioB |
| eggNOG description | Catalyzes the conversion of dethiobiotin (DTB) to biotin by the insertion of a sulfur atom into dethiobiotin via a radical- based mechanism |
| Orthologous group | COG0502 |
| EC number |
EC 2.8.1.6
|
| KEGG orthology |
K01012
|
| KEGG pathways |
map00780, map01100
|
| KEGG modules |
M00123, M00573, M00577
|
| Gene Ontology (8) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.515 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.343 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 88.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 11 in the ORF — 0 in the essential state, 0 growth-defect, 11 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 157.181818182. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -7.45 | 0.0071 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0055 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.028 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0096 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0071 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.018 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.019 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0094 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.007 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.017 | required |
| fitness in mouse infection (in vivo) | -7.45 | 0.0085 | required |
Conditional fitness of transposon-disruption mutants across 71 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 49.0 ppm · rank 1765/3519 (49.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 349 aa |
|---|---|
| Molecular weight | 37.5 kDa |
| Theoretical pI | 4.76 |
| GRAVY | 0.002 (hydrophobic) |
| Aliphatic index | 97.6 |
| Aromaticity | 0.046 |
| Instability index | 39.9 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Radical_SAM | PF04055.28 | 2.6e-20 | 82–239 | Radical SAM superfamily |
BATS | PF06968.19 | 1.7e-19 | 250–339 | Biotin and Thiamin Synthesis associated domain |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 93.2
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8vdw-assembly1_A |
1.00 | 0.96 | 1.4e-37 sig | 8vdw-assembly1_A X-Ray Crystal Structure of the biotin synthase from V. parvula |
8vcw-assembly1_A |
1.00 | 0.92 | 8.8e-33 sig | 8vcw-assembly1_A X-Ray Crystal Structure of the biotin synthase from B. obeum |
1r30-assembly1_A |
1.00 | 0.92 | 5.0e-31 sig | 1r30-assembly1_A The Crystal Structure of Biotin Synthase, an S-Adenosylmethionine-Dependent Radical Enzyme |
5ff0-assembly1_A |
1.00 | 0.83 | 1.4e-21 sig | 5ff0-assembly1_A HydE from T. maritima in complex with S-adenosyl-L-cysteine and methionine |
7o1p-assembly1_A |
1.00 | 0.83 | 3.6e-21 sig | 7o1p-assembly1_A [FeFe]-hydrogenase maturase HydE from T. Maritima (C-ter stretch absent) |
Foldseek search of the AlphaFold DB model (mean pLDDT 93.2, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Catalytic-site verification (M-CSA on the structural model) active site conserved
| M-CSA entry | 767 · EC 2.8.1.6 |
|---|---|
| Catalytic residues | 7/7 identical (7/7 aligned) |
| Verdict | ACTIVE-SITE CONSERVED (7/7 catalytic residues identical) -> likely active enzyme |
Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv1588c (- strand, 447 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1590 (+ strand, 0 bp gap) |
| Predicted operon |
bioB · Rv1590 · Rv1591
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: bioD (ATP-dependent dethiobiotin synthetase BioD), high confidence from genomic context alone (score 997 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1570 bioD exp |
ATP-dependent dethiobiotin synthetase BioD | 999 | 997 ctx | cooccurence:770 coexpression:856 database:900 textmining:954 |
Rv1568 bioA |
adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA | 999 | 976 ctx | fusion:633 cooccurence:756 coexpression:693 textmining:963 |
Rv1590 hyp |
hypothetical protein | 959 | 956 ctx | neighborhood:881 cooccurence:556 |
Rv3279c birA exp |
bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase | 985 | 912 | database:900 textmining:840 |
Rv1569 bioF1 |
8-amino-7-oxononanoate synthase | 990 | 910 ctx | cooccurence:629 coexpression:672 textmining:902 |
Rv1591 |
transmembrane protein | 906 | 906 ctx | neighborhood:881 |
Rv1442 bisC exp |
biotin sulfoxide reductase BisC | 900 | 900 | database:900 |
Rv0032 bioF2 |
8-amino-7-oxononanoate synthase | 923 | 810 | coexpression:669 textmining:613 |
Rv3329 |
aminotransferase | 764 | 733 | coexpression:693 |
Rv0423c thiC |
phosphomethylpyrimidine synthase | 641 | 507 | |
Rv1596 nadC |
nicotinate-nucleotide pyrophosphatase | 481 | 448 | |
Rv1594 nadA |
quinolinate synthetase A | 537 | 447 | coexpression:415 |
Rv2213 pepB |
cytosol aminopeptidase | 464 | 386 | |
Rv1571 hyp |
hypothetical protein | 485 | 342 | |
Rv2524c fas |
fatty acid synthase | 532 | 245 | textmining:406 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: biotin synthetase
- MTBC0 PGAP product: biotin synthase BioB
- Pfam (hmmscan --cut_ga): Radical_SAM PF04055.28 (E=3e-20), BATS PF06968.19 (E=2e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216105.1)
- Domains: Pfam-A via hmmscan --cut_ga — Radical_SAM (PF04055.28), BATS (PF06968.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0502 - Curated reference: UniProt P9WPQ7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 93.2)
- Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 767; catalytic residues aligned onto the structural model
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
39 functional partner(s); context anchor
bioD - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001695|Rv1589|bioB MTQAATRPTNDAGQDGGNNSDILVVARQQVLQRGEGLNQDQVLAVLQLPDDRLEELLALAHEVRMRWCGPEVEVEGIISLKTGGCPEDCHFCSQSGLFASPVRSAWLDIPSLVEAAKQTAKSGATEFCIVAAVRGPDERLMAQVAAGIEAIRNEVEINIACSLGMLTAEQVDQLAARGVHRYNHNLETARSFFANVVTTHTWEERWQTLSMVRDAGMEVCCGGILGMGETLQQRAEFAAELAELGPDEVPLNFLNPRPGTPFADLEVMPVGDALKAVAAFRLALPRTMLRFAGGREITLGDLGAKRGILGGINAVIVGNYLTTLGRPAEADLELLDELQMPLKALNASL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for bioB? Email the maintainer — the message is pre-filled with this gene's details.