Rv1576c Resolved · medium auto-curated

H37Rv Rv1576c · MTBC0 mtbc0_001683 · 68 aa · 1792608–1794025 (-) · RefSeq NP_216092.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage capsid protein
MTBC0 PGAP re-annotationphage major capsid protein
Revised (this work)Phage major capsid protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06614 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable PhiRv1 phage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPhage capsid family
Orthologous groupCOG4653

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS 1.405 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 15 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 2.21% of strains (3211) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1577c (phage prohead protease), high confidence from genomic context alone (score 988 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1577c phage prohead protease 988 988 ctx neighborhood:787 cooccurence:675 coexpression:838
Rv2651c prophage protease 931 925 ctx cooccurence:648 coexpression:783
Rv2650c prophage protein 842 842 coexpression:841
Rv0355c PPE8 PPE family protein PPE8 702 703 ctx cooccurence:700
Rv1452c PE_PGRS28 PE-PGRS family protein PE_PGRS28 699 699 ctx cooccurence:694
Rv3347c PPE55 PPE family protein PPE55 695 696 ctx cooccurence:691
Rv3350c PPE56 PPE family protein PPE56 692 693 ctx cooccurence:689
Rv2490c PE_PGRS43 PE-PGRS family protein PE_PGRS43 692 692 ctx cooccurence:687
Rv1917c PPE34 PPE family protein PPE34 691 692 ctx cooccurence:690
Rv2209 integral membrane protein 689 690 ctx cooccurence:685
Rv0304c PPE5 PPE family protein PPE5 683 684 ctx cooccurence:682
Rv1004c membrane protein 682 682 ctx cooccurence:680
Rv1578c phage protein 687 675 ctx neighborhood:478
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 667 667 ctx cooccurence:499
Rv3343c PPE54 PPE family protein PPE54 665 666 ctx cooccurence:662

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phage capsid protein
  • MTBC0 PGAP product: phage major capsid protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216092.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4653
  • Curated reference: UniProt O06614 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 73 functional partner(s); context anchor Rv1577c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001683|Rv1576c|
MTEFDDIKNLSLPETRDAAKQLLDSVAGDLTGEAAQRFQALTRHAEELRAEQRRRGREAEEAAPLPGR