Rv1591 Still unknown · low auto-curated

H37Rv Rv1591 · MTBC0 mtbc0_001697 · 221 aa · 1803534–1804199 (+) · RefSeq NP_216107.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationDUF2567 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF2567. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLT5 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1591

UniProt still lists this protein as Uncharacterized protein Rv1591; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF2567)
Orthologous group2BBTC
Gene Ontology (13) GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0044425, GO:0044459, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.688 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF2567PF10821.14 4.1e-8133–198 Protein of unknown function (DUF2567)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: bioB (biotin synthetase), high confidence from genomic context alone (score 906 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1589 bioB biotin synthetase 906 906 ctx neighborhood:881
Rv1590 hyp hypothetical protein 887 887 ctx neighborhood:881

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: DUF2567 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF2567 PF10821.14 (E=4e-81)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216107.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF2567 (PF10821.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BBTC
  • Curated reference: UniProt P9WLT5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s); context anchor bioB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001697|Rv1591|
MTEPPGFGGPSEPSGAPRTSRTRAVLFVMLGLSATGVLVGGLWAWIAPPIHAVVAITRAGERVHEYLGSESQNFFIAPFMLLGLLSVLAVVASALMWQWREHRGPQMVAGLSIGLTTAAAIAAGVGALVVRLRYGALDFDTVPLSRGDHALTYVTQAPPVFFARRPLQIALTLMWPAGIASLVYALLAAGTARDDLGGYPAVDPSSNARTEALETPQAPVS