Rv1580c Family assigned · low

H37Rv Rv1580c · MTBC0 mtbc0_001687 · 74 aa · 1795581–1795805 (-) · RefSeq NP_216096.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Prophage phiRv1 protein; serologically detectable antigen (M. bovis diagnostic serology). A prophage-encoded protein of unknown molecular function.

Curated reference (UniProt)

UniProt O06610 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv1 phage protein

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.40% of strains (574) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1579c (phage protein), high confidence from genomic context alone (score 776 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1579c phage protein 776 776 ctx neighborhood:773
Rv1581c phage protein 755 756 ctx neighborhood:752
Rv1578c phage protein 560 560 ctx neighborhood:557
Rv1582c phage protein 443 442 ctx neighborhood:436
Rv1584c phage protein 439 438 ctx neighborhood:436
Rv1583c phage protein 437 437 ctx neighborhood:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • PhiRv1 prophage protein; diagnostic antigen (Kwok 2010, PMID 20096429)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216096.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt O06610 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 6 functional partner(s); context anchor Rv1579c
  • Primary literature: Kwok HF, Scott CJ, Snoddy P, Buick RJ, Johnston JA, Olwill SA (2010). Expression and purification of diagnostically sensitive mycobacterial (Mycobacterium bovis) antigens and profiling of their humoral immune response in a rabbit model Res Vet Sci 89(1):41-7. doi:10.1016/j.rvsc.2009.12.015 PMID:20096429

Ancestral MTBC0 protein sequence

>mtbc0_001687|Rv1580c|
MAFNADVGMATCKRCGDAVPYIILPNLQTGEPVMGVADNKWKRANCPVDVGKPCPFLIAEGVADSTDDTIEVDQ