Rv1580c Family assigned · low
H37Rv Rv1580c · MTBC0 mtbc0_001687 ·
74 aa · 1795581–1795805 (-) ·
RefSeq NP_216096.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phage protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Prophage phiRv1 protein; serologically detectable antigen (M. bovis diagnostic serology). A prophage-encoded protein of unknown molecular function. |
Curated reference (UniProt)
| UniProt |
O06610
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable PhiRv1 phage protein |
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.40% of strains (574) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1579c (phage protein), high confidence from genomic context alone (score 776 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1579c |
phage protein | 776 | 776 ctx | neighborhood:773 |
Rv1581c |
phage protein | 755 | 756 ctx | neighborhood:752 |
Rv1578c |
phage protein | 560 | 560 ctx | neighborhood:557 |
Rv1582c |
phage protein | 443 | 442 ctx | neighborhood:436 |
Rv1584c |
phage protein | 439 | 438 ctx | neighborhood:436 |
Rv1583c |
phage protein | 437 | 437 ctx | neighborhood:436 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- PhiRv1 prophage protein; diagnostic antigen (Kwok 2010, PMID 20096429)
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216096.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt O06610 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
6 functional partner(s); context anchor
Rv1579c - Primary literature: Kwok HF, Scott CJ, Snoddy P, Buick RJ, Johnston JA, Olwill SA (2010). Expression and purification of diagnostically sensitive mycobacterial (Mycobacterium bovis) antigens and profiling of their humoral immune response in a rabbit model Res Vet Sci 89(1):41-7. doi:10.1016/j.rvsc.2009.12.015 PMID:20096429
Ancestral MTBC0 protein sequence
>mtbc0_001687|Rv1580c| MAFNADVGMATCKRCGDAVPYIILPNLQTGEPVMGVADNKWKRANCPVDVGKPCPFLIAEGVADSTDDTIEVDQ