cut3 Family assigned · medium auto-curated

H37Rv Rv3451 · MTBC0 mtbc0_003670 · 262 aa · 3898502–3899290 MTBC0 (+) · RefSeq NP_217968.2

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand mrsA (Rv3441c) — requalified: phosphoglucosamine mutase rpsI (Rv3442c) — requalified: 30S ribosomal protein S9 rplM (Rv3443c) — requalified: 50S ribosomal protein L13 esxT (Rv3444c) — family_assigned: WXG100 family type VII secretion target esxU (Rv3445c) — requalified: type VII secretion system ESX-4 protein EsxU Rv3446c (Rv3446c) — family_assigned: type VII secretion-associated protein Rv3446c eccC4 (Rv3447c) — family_assigned: type VII secretion system ESX-4 FtsK/SpoIIIE family ATPase E eccC4 eccD4 (Rv3448) — family_assigned: type VII secretion system ESX-4 subunit EccD4 eccD4 mycP4 (Rv3449) — requalified: type VII secretion system ESX-4 serine protease mycosin MycP mycP4 eccB4 (Rv3450c) — family_assigned: type VII secretion system ESX-4 subunit EccB4 eccB4 cut3 (Rv3451) — family_assigned: cutinase family protein cut4 (Rv3452) — requalified: cutinase Cut4 rplQ (Rv3456c) — requalified: 50S ribosomal protein L17 rpoA (Rv3457c) — family_assigned: DNA-directed RNA polymerase subunit alpha rpoA rpsD (Rv3458c) — requalified: 30S ribosomal protein S4 rpsK (Rv3459c) — requalified: 30S ribosomal protein S11 rpsM (Rv3460c) — requalified: 30S ribosomal protein S13 rpmJ (Rv3461c) — requalified: 50S ribosomal protein L36 Rv3463 (Rv3463) — requalified: LLM class F420-dependent oxidoreductase Rv3463 rmlB (Rv3464) — requalified: dTDP-glucose 4%2C6-dehydratase rmlB rmlC (Rv3465) — requalified: dTDP-4-dehydrorhamnose 3%2C5-epimerase 3 888 kb 3 892 kb 3 896 kb 3 900 kb 3 904 kb 3 908 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cutinase
MTBC0 PGAP re-annotationcutinase family protein
Revised (this work)Cutinase family protein. Pfam: Cutinase (PF01083.29).
Functional category (TubercuList)cell wall and cell processes

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 3 publications

3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).

PublicationDate
Proteomic insights into the adaptation of Mycobacterium bovis to hypoxic conditions. doi:10.1016/j.tube.2026.102739 2026
Roles of Triolein and Lipolytic Protein in the Pathogenesis and Survival of Mycobacterium tuberculosis: a Novel Therapeutic Approach. doi:10.1007/s12010-015-1953-z 2016
Comparative metabolic profiling of mce1 operon mutant vs wild-type Mycobacterium tuberculosis strains. doi:10.1093/femspd/ftv066 2015

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder17% of residues (metapredict) · mean AlphaFold pLDDT 82.5
Disordered regions2 IDR(s), longest 26 aa [0-19, 236-262]

carries a substantial disordered region (45/262 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

CRISPRi vulnerability

Vulnerability index 0.48 (95% CI -0.97 to 2.44). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionHydrolysis of cutin (a polyester that forms the structure of plant cuticle). Shown to have TDM-specific hydrolase activity (see Yang et al. 2014).
Mycobrowser EC 3.1.1.74 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3481 · 99.6% identity
M. marinum MMAR_1098 · 71.2% identity
M. smegmatis MSMEG_2095 · 62.0% identity
M. orygis RJtmp_003560 · 99.6% identity
M. abscessus MAB_3766 · 46.8% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WP39 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable carboxylesterase Culp3
EC (curated) EC 3.1.1.-
Curated functionShows weak esterase activity with the p-nitrophenol-linked aliphatic ester pNP-butyrate. Does not exhibit cutinase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namecut3
eggNOG descriptionCatalyzes the hydrolysis of cutin, a polyester that forms the structure of plant cuticle
Orthologous group2A1QU
EC number EC 3.1.1.74
KEGG orthology K08095

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.801 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 11 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.54% of strains (784) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.244 · 11 consensus substitution(s)
under purifying selection vs M. canettii (deep divergence; dN/dS=0.244) — a real, constrained gene predating the MTBC clonal expansion
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 67.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 45.8%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 15 in the ORF — 0 in the essential state, 0 growth-defect, 15 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 166. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 11 of 16 independent MS datasets
Integrated abundance32.1 ppm · rank 2032/3519 (42.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length262 aa
Molecular weight26.5 kDa
Theoretical pI6.57
GRAVY0.206 (hydrophobic)
Aliphatic index91.6
Aromaticity0.057
Instability index39.2 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CutinasePF01083.29 1.9e-5344–226 Cutinase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.5

PDB hitprobTM-scoreE-valueDescription
1xzc-assembly1_A 1.00 0.76 2.9e-11 sig 1xzc-assembly1_A FUSARIUM SOLANI CUTINASE MUTANT WITH SER 129 REPLACED BY CYS COMPLEX WITH PARA-SULFUROUSPHENYL MERCURY
1xzh-assembly1_A 1.00 0.76 4.7e-11 sig 1xzh-assembly1_A FUSARIUM SOLANI CUTINASE MUTANT WITH THR 80 REPLACED BY PRO
1xze-assembly1_A 1.00 0.75 4.1e-11 sig 1xze-assembly1_A FUSARIUM SOLANI CUTINASE MUTANT WITH SER 92 REPLACED BY CYS
1cui-assembly1_A 1.00 0.75 6.7e-11 sig 1cui-assembly1_A CUTINASE, S120A MUTANT
1xzg-assembly1_A 1.00 0.76 8.0e-11 sig 1xzg-assembly1_A FUSARIUM SOLANI CUTINASE MUTANT WITH THR 45 REPLACED BY ALA

Foldseek search of the AlphaFold DB model (mean pLDDT 82.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Catalytic-site verification (M-CSA on the structural model) active site conserved

M-CSA entry631 · EC 3.1.1.74
Catalytic residues4/5 identical (5/5 aligned)
VerdictACTIVE-SITE CONSERVED (4/5 catalytic residues identical) -> likely active enzyme

Catalytic residues of the matched M-CSA reference enzyme mapped onto the structural model by alignment. An active-site-conserved verdict upgrades a mere fold match to a likely active enzyme; fold-only flags a shared fold whose catalytic machinery is not retained (a guard against over-calling).

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)eccB4 (- strand, 120 bp gap)
Downstream (3' on genome)cut4 (+ strand, 46 bp gap)
Predicted operon cut3 · cut4

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (1 TF) whiB5 (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: eccB4 (ESX-4 secretion system protein EccB4), high confidence from genomic context alone (score 770 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3450c eccB4 ESX-4 secretion system protein EccB4 770 770 ctx neighborhood:769
Rv3452 cut4 cutinase 706 690 ctx neighborhood:671
Rv1278 hyp exp hypothetical protein 649 649 database:544
Rv1747 exp ABC transporter ATP-binding protein/permease 660 648 database:530
Rv0153c ptbB exp phosphotyrosine protein phosphatase 651 637 experimental:629
Rv3157 nuoM exp NADH-quinone oxidoreductase subunit M 647 629 experimental:629
Rv0434 hyp exp hypothetical protein 607 608 database:561
Rv3036c TB22.2 hyp exp hypothetical protein 601 598 database:543
Rv2328 PE23 exp PE family protein PE23 601 598 database:543
Rv3812 PE_PGRS62 exp PE-PGRS family protein PE_PGRS62 601 598 database:543
Rv0832 PE_PGRS12 exp PE-PGRS family protein PE_PGRS12 601 598 database:543
Rv0020c fhaA exp FHA domain-containing protein FhaA 597 598 database:530
Rv0019c fhaB exp FHA domain-containing protein FhaB 596 596 database:530
Rv3360 hyp exp hypothetical protein 595 596 database:530
Rv1827 garA exp glycogen accumulation regulator GarA 595 595 database:530

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: cutinase
  • MTBC0 PGAP product: cutinase family protein
  • Pfam (hmmscan --cut_ga): Cutinase PF01083.29 (E=2e-53)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217968.2)
  • Domains: Pfam-A via hmmscan --cut_ga — Cutinase (PF01083.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A1QU
  • Curated reference: UniProt P9WP39 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.5)
  • Catalytic-site verification: M-CSA (Ribeiro et al. 2018, doi:10.1093/nar/gkx1012), entry 631; catalytic residues aligned onto the structural model
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 75 functional partner(s); context anchor eccB4
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003670|Rv3451|cut3
MNNRPIRLLTSGRAGLGAGALITAVVLLIALGAVWTPVAFADGCPDAEVTFARGTGEPPGIGRVGQAFVDSLRQQTGMEIGVYPVNYAASRLQLHGGDGANDAISHIKSMASSCPNTKLVLGGYSQGATVIDIVAGVPLGSISFGSPLPAAYADNVAAVAVFGNPSNRAGGSLSSLSPLFGSKAIDLCNPTDPICHVGPGNEFSGHIDGYIPTYTTQAASFVVQRLRAGSVPHLPGSVPQLPGSVLQMPGTAAPAPESLHGR