Rv1585c Family assigned · low
H37Rv Rv1585c · MTBC0 mtbc0_001692 ·
171 aa · 1798544–1799059 (-) ·
RefSeq NP_216101.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phage protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Prophage phiRv1 protein (within region-of-difference RD149). RefSeq leaves it of unknown function. Part of the phiRv1 prophage-like element, variably deleted in Beijing-lineage isolates (Stavrum 2008). Molecular function unknown. |
Curated reference (UniProt)
| UniProt |
O06605
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible phage PhiRv1 protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2B8PQ |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1586c (phage integrase), high confidence from genomic context alone (score 971 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1586c |
phage integrase | 971 | 971 ctx | neighborhood:801 coexpression:860 |
Rv1587c hyp |
hypothetical protein | 788 | 788 ctx | neighborhood:773 |
Rv1588c hyp |
hypothetical protein | 778 | 778 ctx | neighborhood:773 |
Rv1582c |
phage protein | 628 | 628 ctx | neighborhood:605 |
Rv1584c |
phage protein | 931 | 612 ctx | neighborhood:605 textmining:830 |
Rv1583c |
phage protein | 612 | 612 ctx | neighborhood:606 |
Rv1573 |
phage protein | 547 | 55 | textmining:541 |
Rv0595c vapC4 |
ribonuclease VapC4 | 516 | 54 | textmining:510 |
Rv1801 PPE29 |
PPE family protein PPE29 | 441 | 50 | textmining:436 |
Rv1721c vapB12 |
antitoxin VapB12 | 543 | 47 | textmining:541 |
Rv0071 |
maturase | 528 | 47 | textmining:526 |
Rv1802 PPE30 |
PPE family protein PPE30 | 517 | 44 | textmining:516 |
Rv2212 |
adenylyl cyclase | 437 | 44 | textmining:436 |
Rv1572c |
Conserved hypothetical protein; Rv1572c, (MTCY336.31B), len: 34 aa. Partial ORF,part of REP13E12 repeat element; 3' end of Rv1587c (MTCY336. | 870 | 43 | textmining:870 |
Rv1761c hyp |
hypothetical protein | 659 | 42 | textmining:659 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- phiRv1 prophage / RD149 protein; variably deleted in Beijing isolates (Stavrum 2008, PMID 18398483)
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216101.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B8PQ - Curated reference: UniProt O06605 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
Rv1586c - Primary literature: Stavrum R, Valvatne H, Bo TH, Jonassen I, Hinds J, Butcher PD, Grewal HM (2008). Genomic diversity among Beijing and non-Beijing Mycobacterium tuberculosis isolates from Myanmar PLoS One 3(4):e1973. doi:10.1371/journal.pone.0001973 PMID:18398483
Ancestral MTBC0 protein sequence
>mtbc0_001692|Rv1585c| MSRHHNIVIVCDHGRKGDGRIEHKRCDLVAPIIWVDETQGWLPQAPAVATLLDDDNQPRAVIGLPPNESRLRPEMRRDGWVRLHWEFACLRYGAAGVRTCEQRPVRVRNGDLQTLCENVPRLLTGLAGNPDYAPGFAVQSDAVVVAMWLWRTLCESDTPNKLRATPTRGSC