Rv1585c Family assigned · low

H37Rv Rv1585c · MTBC0 mtbc0_001692 · 171 aa · 1798544–1799059 (-) · RefSeq NP_216101.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Prophage phiRv1 protein (within region-of-difference RD149). RefSeq leaves it of unknown function. Part of the phiRv1 prophage-like element, variably deleted in Beijing-lineage isolates (Stavrum 2008). Molecular function unknown.

Curated reference (UniProt)

UniProt O06605 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible phage PhiRv1 protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B8PQ

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1586c (phage integrase), high confidence from genomic context alone (score 971 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1586c phage integrase 971 971 ctx neighborhood:801 coexpression:860
Rv1587c hyp hypothetical protein 788 788 ctx neighborhood:773
Rv1588c hyp hypothetical protein 778 778 ctx neighborhood:773
Rv1582c phage protein 628 628 ctx neighborhood:605
Rv1584c phage protein 931 612 ctx neighborhood:605 textmining:830
Rv1583c phage protein 612 612 ctx neighborhood:606
Rv1573 phage protein 547 55 textmining:541
Rv0595c vapC4 ribonuclease VapC4 516 54 textmining:510
Rv1801 PPE29 PPE family protein PPE29 441 50 textmining:436
Rv1721c vapB12 antitoxin VapB12 543 47 textmining:541
Rv0071 maturase 528 47 textmining:526
Rv1802 PPE30 PPE family protein PPE30 517 44 textmining:516
Rv2212 adenylyl cyclase 437 44 textmining:436
Rv1572c Conserved hypothetical protein; Rv1572c, (MTCY336.31B), len: 34 aa. Partial ORF,part of REP13E12 repeat element; 3' end of Rv1587c (MTCY336. 870 43 textmining:870
Rv1761c hyp hypothetical protein 659 42 textmining:659

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • phiRv1 prophage / RD149 protein; variably deleted in Beijing isolates (Stavrum 2008, PMID 18398483)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216101.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B8PQ
  • Curated reference: UniProt O06605 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor Rv1586c
  • Primary literature: Stavrum R, Valvatne H, Bo TH, Jonassen I, Hinds J, Butcher PD, Grewal HM (2008). Genomic diversity among Beijing and non-Beijing Mycobacterium tuberculosis isolates from Myanmar PLoS One 3(4):e1973. doi:10.1371/journal.pone.0001973 PMID:18398483

Ancestral MTBC0 protein sequence

>mtbc0_001692|Rv1585c|
MSRHHNIVIVCDHGRKGDGRIEHKRCDLVAPIIWVDETQGWLPQAPAVATLLDDDNQPRAVIGLPPNESRLRPEMRRDGWVRLHWEFACLRYGAAGVRTCEQRPVRVRNGDLQTLCENVPRLLTGLAGNPDYAPGFAVQSDAVVVAMWLWRTLCESDTPNKLRATPTRGSC