hisA Resolved · high auto-curated

H37Rv Rv1603 · MTBC0 mtbc0_001709 · 245 aa · 1815258–1815995 MTBC0 (+) · RefSeq NP_216119.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv1591 (Rv1591) — dark: DUF2567 domain-containing protein Rv1592c (Rv1592c) — family_assigned: lipase family protein Rv1592c Rv1593c (Rv1593c) — family_assigned: NUDIX domain-containing protein nadB (Rv1595) — requalified: L-aspartate oxidase nadB nadC (Rv1596) — requalified: carboxylating nicotinate-nucleotide diphosphorylase nadC Rv1597 (Rv1597) — family_assigned: methyltransferase domain-containing protein Rv1598c (Rv1598c) — family_assigned: nitroreductase family deazaflavin-dependent oxidoreductase hisD (Rv1599) — requalified: histidinol dehydrogenase hisD hisB (Rv1601) — requalified: imidazoleglycerol-phosphate dehydratase HisB hisH (Rv1602) — family_assigned: imidazole glycerol phosphate synthase subunit HisH hisA (Rv1603) — requalified: bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino) impA (Rv1604) — family_assigned: inositol monophosphatase family protein hisF (Rv1605) — family_assigned: imidazole glycerol phosphate synthase subunit HisF hisI (Rv1606) — requalified: phosphoribosyl-AMP cyclohydrolase chaA (Rv1607) — requalified: calcium:proton antiporter chaA bcpB (Rv1608c) — requalified: peroxiredoxin BcpB trpE (Rv1609) — requalified: anthranilate synthase component I trpE Rv1610 (Rv1610) — family_assigned: TIGR02234 family membrane protein trpC (Rv1611) — requalified: indole-3-glycerol phosphate synthase TrpC trpA (Rv1613) — family_assigned: tryptophan synthase subunit alpha lgt (Rv1614) — requalified: prolipoprotein diacylglyceryl transferase lgt Rv1615 (Rv1615) — family_assigned: TM2 domain-containing protein 1 804 kb 1 808 kb 1 812 kb 1 816 kb 1 820 kb 1 824 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
MTBC0 PGAP re-annotationbifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA
Revised (this work)Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA. Pfam: His_biosynth (PF00977.28).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 4 publications

4 TB publications mention this gene. 4 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
Evolution of substrate specificity in a recipient's enzyme following horizontal gene transfer. doi:10.1093/molbev/mst115 2013
Bisubstrate specificity in histidine/tryptophan biosynthesis isomerase from Mycobacterium tuberculosis by active site metamorphosis. doi:10.1073/pnas.1015996108 2011
Occurrence of a putative ancient-like isomerase involved in histidine and tryptophan biosynthesis. doi:10.1038/sj.embor.embor771 2003
A Mycobacterium smegmatis mutant with a defective inositol monophosphate phosphatase gene homolog has altered cell envelope permeability. doi:10.1128/jb.179.24.7827-7833.1997 1997

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -9.05 (95% CI -10.20 to -8.00). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionHistidine biosynthesis pathway (fourth step) [catalytic activity: N-(5'-phospho-D-ribosylformimino)-5-amino-1-(5''-phosphoribosyl)-4-imidazolecarb oxamide = N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phosphoribosyl)-4- imidazolecarboxamide.]
Mycobrowser EC 5.3.1.16, 5.3.1.24 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1629 · 100.0% identity
M. leprae ML1261 · 84.8% identity
M. marinum MMAR_2399 · 89.7% identity
M. smegmatis MSMEG_3209 · 85.5% identity
M. orygis RJtmp_001675 · 100.0% identity
M. abscessus MAB_2666c · 78.5% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WMM5 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphoribosyl isomerase A
EC (curated) EC 5.3.1.16, EC 5.3.1.24
Curated functionInvolved in both the histidine and tryptophan biosynthetic pathways.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namehisA
eggNOG descriptionInvolved in both the histidine and tryptophan biosynthetic pathways
Orthologous groupCOG0106
EC number EC 5.3.1.16, EC 5.3.1.24
KEGG orthology K01814, K01817
KEGG pathways map00340, map00400, map01100, map01110, map01130, map01230
KEGG modules M00023, M00026
Gene Ontology (60) GO:0000105, GO:0000162, GO:0003674, GO:0003824, GO:0003949, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006520, GO:0006547 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.082 · 40 consensus substitution(s) · 1 canettii-fixed disruption
under purifying selection vs M. canettii (deep divergence; dN/dS=0.082) — a real, constrained gene predating the MTBC clonal expansion; carries 1 M. canettii-clade-fixed disruptive substitution(s) (candidate lineage-specific pseudogenisation — cross-check the intra-MTBC pseudogene layer)
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 89.3% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 64.1%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 10 in the ORF — 9 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.100, mean read count 10. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph strainRv1603-hisA_TetOn6.2 (TetON promoter 6)
Baseline knockdown fitness2.098 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Proteomics (mass spectrometry) detected

MS detectiondetected in 14 of 16 independent MS datasets
Integrated abundance176.0 ppm · rank 911/3519 (74.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length245 aa
Molecular weight25.8 kDa
Theoretical pI4.66
GRAVY0.045 (hydrophobic)
Aliphatic index105.5
Aromaticity0.041
Instability index20.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
His_biosynthPF00977.28 5.1e-636–234 Histidine biosynthesis protein

Experimental structures (Protein Data Bank) 4 solved

PDBMethodResolutionCoverage
2y88 X-ray diffraction 1.33 Å 100%
3zs4 X-ray diffraction 1.9 Å 100%
2y85 X-ray diffraction 2.4 Å 100%
2y89 X-ray diffraction 2.5 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.6

PDB hitprobTM-scoreE-valueDescription
3zs4-assembly1_A 1.00 1.00 1.0e-50 sig 3zs4-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND PRFAR
2y88-assembly1_A 1.00 1.00 2.4e-49 sig 2y88-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE (VARIANT D11N) WITH BOUND PRFAR
2y85-assembly2_B 1.00 0.97 7.6e-44 sig 2y85-assembly2_B CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP
2y85-assembly1_A 1.00 0.96 9.6e-44 sig 2y85-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP
2y85-assembly4_D 1.00 0.97 2.3e-42 sig 2y85-assembly4_D CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP

Foldseek search of the AlphaFold DB model (mean pLDDT 96.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 8

Upstream (5' on genome)hisH (+ strand, 9 bp gap)
Downstream (3' on genome)impA (+ strand, 7 bp gap)
Predicted operon hisD · hisC1 · hisB · hisH · hisA · impA · hisF · hisI

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: hisF (imidazole glycerol phosphate synthase subunit HisF), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1605 hisF exp imidazole glycerol phosphate synthase subunit HisF 999 1000 ctx neighborhood:881 fusion:704 coexpression:968 database:900 textmining:600
Rv1602 hisH exp imidazole glycerol phosphate synthase subunit HisH 999 1000 ctx neighborhood:876 cooccurence:765 coexpression:970 database:900 textmining:632
Rv1606 hisI exp phosphoribosyl-AMP cyclohydrolase 999 1000 ctx neighborhood:881 fusion:889 cooccurence:769 coexpression:968 database:900 textmining:590
Rv1601 hisB imidazole glycerol-phosphate dehydratase 999 999 ctx neighborhood:876 cooccurence:770 coexpression:967 textmining:822
Rv1599 hisD histidinol dehydrogenase 999 997 ctx neighborhood:876 cooccurence:771 coexpression:918 textmining:882
Rv1600 hisC1 histidinol-phosphate aminotransferase 998 997 ctx neighborhood:876 cooccurence:680 coexpression:920 textmining:567
Rv1604 impA inositol-monophosphatase ImpA 997 983 ctx neighborhood:882 coexpression:860 textmining:879
Rv2121c hisG ATP phosphoribosyltransferase 996 961 ctx cooccurence:705 coexpression:857 textmining:911
Rv1611 trpC exp indole-3-glycerol phosphate synthase 979 928 database:900 textmining:725
Rv2192c trpD exp anthranilate phosphoribosyltransferase 961 909 database:900 textmining:599
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 963 886 coexpression:857 textmining:693
Rv3396c guaA GMP synthase 842 777 coexpression:651
Rv3772 hisC2 histidinol-phosphate aminotransferase 791 769 coexpression:692
Rv2231c cobC aminotransferase 778 754 coexpression:693
Rv2202c adoK adenosine kinase 713 702 coexpression:692

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
  • MTBC0 PGAP product: bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA
  • Pfam (hmmscan --cut_ga): His_biosynth PF00977.28 (E=5e-63)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216119.1)
  • Domains: Pfam-A via hmmscan --cut_ga — His_biosynth (PF00977.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0106
  • Curated reference: UniProt P9WMM5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.6)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor hisF
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001709|Rv1603|hisA
MMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD