hisA Resolved · high auto-curated
H37Rv Rv1603 · MTBC0 mtbc0_001709 ·
245 aa ·
1815258–1815995 MTBC0
(+) ·
RefSeq NP_216119.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase |
|---|---|
| MTBC0 PGAP re-annotation | bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA |
| Revised (this work) | Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA. Pfam: His_biosynth (PF00977.28). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Evolution of substrate specificity in a recipient's enzyme following horizontal gene transfer. doi:10.1093/molbev/mst115 | 2013 |
| Bisubstrate specificity in histidine/tryptophan biosynthesis isomerase from Mycobacterium tuberculosis by active site metamorphosis. doi:10.1073/pnas.1015996108 | 2011 |
| Occurrence of a putative ancient-like isomerase involved in histidine and tryptophan biosynthesis. doi:10.1038/sj.embor.embor771 | 2003 |
| A Mycobacterium smegmatis mutant with a defective inositol monophosphate phosphatase gene homolog has altered cell envelope permeability. doi:10.1128/jb.179.24.7827-7833.1997 | 1997 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -9.05 (95% CI -10.20 to -8.00). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Histidine biosynthesis pathway (fourth step) [catalytic activity: N-(5'-phospho-D-ribosylformimino)-5-amino-1-(5''-phosphoribosyl)-4-imidazolecarb oxamide = N-(5'-phospho-D-1'-ribulosylformimino)-5-amino-1-(5''-phosphoribosyl)-4- imidazolecarboxamide.] |
|---|---|
| Mycobrowser EC |
5.3.1.16, 5.3.1.24
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1629
· 100.0% identity |
|---|---|
| M. leprae |
ML1261
· 84.8% identity |
| M. marinum |
MMAR_2399
· 89.7% identity |
| M. smegmatis |
MSMEG_3209
· 85.5% identity |
| M. orygis |
RJtmp_001675
· 100.0% identity |
| M. abscessus |
MAB_2666c
· 78.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WMM5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosyl isomerase A |
| EC (curated) |
EC 5.3.1.16, EC 5.3.1.24
|
| Curated function | Involved in both the histidine and tryptophan biosynthetic pathways. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
E Amino acid transport and metabolism
|
|---|---|
| Preferred name | hisA |
| eggNOG description | Involved in both the histidine and tryptophan biosynthetic pathways |
| Orthologous group | COG0106 |
| EC number |
EC 5.3.1.16, EC 5.3.1.24
|
| KEGG orthology |
K01814, K01817
|
| KEGG pathways |
map00340, map00400, map01100, map01110, map01130, map01230
|
| KEGG modules |
M00023, M00026
|
| Gene Ontology (60) |
GO:0000105, GO:0000162, GO:0003674, GO:0003824, GO:0003949, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006520, GO:0006547 +48 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.082
· 40 consensus substitution(s) · 1 canettii-fixed disruption under purifying selection vs M. canettii (deep divergence; dN/dS=0.082) — a real, constrained gene predating the MTBC clonal expansion; carries 1 M. canettii-clade-fixed disruptive substitution(s) (candidate lineage-specific pseudogenisation — cross-check the intra-MTBC pseudogene layer) |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 89.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 64.1% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 10 in the ORF — 9 in the essential state, 0 growth-defect, 1 non-essential, 0 growth-advantage. Saturation 0.100, mean read count 10. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv1603-hisA_TetOn6.2 (TetON promoter 6) |
|---|---|
| Baseline knockdown fitness | 2.098 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 14 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 176.0 ppm · rank 911/3519 (74.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 245 aa |
|---|---|
| Molecular weight | 25.8 kDa |
| Theoretical pI | 4.66 |
| GRAVY | 0.045 (hydrophobic) |
| Aliphatic index | 105.5 |
| Aromaticity | 0.041 |
| Instability index | 20.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
His_biosynth | PF00977.28 | 5.1e-63 | 6–234 | Histidine biosynthesis protein |
Experimental structures (Protein Data Bank) 4 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
2y88 |
X-ray diffraction | 1.33 Å | 100% |
3zs4 |
X-ray diffraction | 1.9 Å | 100% |
2y85 |
X-ray diffraction | 2.4 Å | 100% |
2y89 |
X-ray diffraction | 2.5 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (4 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 96.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3zs4-assembly1_A |
1.00 | 1.00 | 1.0e-50 sig | 3zs4-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND PRFAR |
2y88-assembly1_A |
1.00 | 1.00 | 2.4e-49 sig | 2y88-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE (VARIANT D11N) WITH BOUND PRFAR |
2y85-assembly2_B |
1.00 | 0.97 | 7.6e-44 sig | 2y85-assembly2_B CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP |
2y85-assembly1_A |
1.00 | 0.96 | 9.6e-44 sig | 2y85-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP |
2y85-assembly4_D |
1.00 | 0.97 | 2.3e-42 sig | 2y85-assembly4_D CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS PHOSPHORIBOSYL ISOMERASE WITH BOUND RCDRP |
Foldseek search of the AlphaFold DB model (mean pLDDT 96.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 8
| Upstream (5' on genome) | hisH (+ strand, 9 bp gap) |
|---|---|
| Downstream (3' on genome) | impA (+ strand, 7 bp gap) |
| Predicted operon |
hisD · hisC1 · hisB · hisH · hisA · impA · hisF · hisI
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: hisF (imidazole glycerol phosphate synthase subunit HisF), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1605 hisF exp |
imidazole glycerol phosphate synthase subunit HisF | 999 | 1000 ctx | neighborhood:881 fusion:704 coexpression:968 database:900 textmining:600 |
Rv1602 hisH exp |
imidazole glycerol phosphate synthase subunit HisH | 999 | 1000 ctx | neighborhood:876 cooccurence:765 coexpression:970 database:900 textmining:632 |
Rv1606 hisI exp |
phosphoribosyl-AMP cyclohydrolase | 999 | 1000 ctx | neighborhood:881 fusion:889 cooccurence:769 coexpression:968 database:900 textmining:590 |
Rv1601 hisB |
imidazole glycerol-phosphate dehydratase | 999 | 999 ctx | neighborhood:876 cooccurence:770 coexpression:967 textmining:822 |
Rv1599 hisD |
histidinol dehydrogenase | 999 | 997 ctx | neighborhood:876 cooccurence:771 coexpression:918 textmining:882 |
Rv1600 hisC1 |
histidinol-phosphate aminotransferase | 998 | 997 ctx | neighborhood:876 cooccurence:680 coexpression:920 textmining:567 |
Rv1604 impA |
inositol-monophosphatase ImpA | 997 | 983 ctx | neighborhood:882 coexpression:860 textmining:879 |
Rv2121c hisG |
ATP phosphoribosyltransferase | 996 | 961 ctx | cooccurence:705 coexpression:857 textmining:911 |
Rv1611 trpC exp |
indole-3-glycerol phosphate synthase | 979 | 928 | database:900 textmining:725 |
Rv2192c trpD exp |
anthranilate phosphoribosyltransferase | 961 | 909 | database:900 textmining:599 |
Rv2122c hisE |
phosphoribosyl-ATP pyrophosphatase | 963 | 886 | coexpression:857 textmining:693 |
Rv3396c guaA |
GMP synthase | 842 | 777 | coexpression:651 |
Rv3772 hisC2 |
histidinol-phosphate aminotransferase | 791 | 769 | coexpression:692 |
Rv2231c cobC |
aminotransferase | 778 | 754 | coexpression:693 |
Rv2202c adoK |
adenosine kinase | 713 | 702 | coexpression:692 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
- MTBC0 PGAP product: bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA
- Pfam (hmmscan --cut_ga): His_biosynth PF00977.28 (E=5e-63)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216119.1)
- Domains: Pfam-A via hmmscan --cut_ga — His_biosynth (PF00977.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0106 - Curated reference: UniProt P9WMM5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 96.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
58 functional partner(s); context anchor
hisF - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001709|Rv1603|hisA MMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for hisA? Email the maintainer — the message is pre-filled with this gene's details.