hisA Resolved · high auto-curated

H37Rv Rv1603 · MTBC0 mtbc0_001709 · 245 aa · 1815258–1815995 (+) · RefSeq NP_216119.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
MTBC0 PGAP re-annotationbifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA
Revised (this work)Bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA. Pfam: His_biosynth (PF00977.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WMM5 SwissProt · reviewed · Evidence at protein level
UniProt namePhosphoribosyl isomerase A
EC (curated) EC 5.3.1.16, EC 5.3.1.24
Curated functionInvolved in both the histidine and tryptophan biosynthetic pathways.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namehisA
eggNOG descriptionInvolved in both the histidine and tryptophan biosynthetic pathways
Orthologous groupCOG0106
EC number EC 5.3.1.16, EC 5.3.1.24
KEGG orthology K01814, K01817
KEGG pathways map00340, map00400, map01100, map01110, map01130, map01230
KEGG modules M00023, M00026
Gene Ontology (60) GO:0000105, GO:0000162, GO:0003674, GO:0003824, GO:0003949, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006082, GO:0006520, GO:0006547 +48 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
His_biosynthPF00977.28 5.1e-636–234 Histidine biosynthesis protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hisF (imidazole glycerol phosphate synthase subunit HisF), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1605 hisF imidazole glycerol phosphate synthase subunit HisF 999 1000 ctx neighborhood:881 fusion:704 coexpression:968 database:900 textmining:600
Rv1602 hisH imidazole glycerol phosphate synthase subunit HisH 999 1000 ctx neighborhood:876 cooccurence:765 coexpression:970 database:900 textmining:632
Rv1606 hisI phosphoribosyl-AMP cyclohydrolase 999 1000 ctx neighborhood:881 fusion:889 cooccurence:769 coexpression:968 database:900 textmining:590
Rv1601 hisB imidazole glycerol-phosphate dehydratase 999 999 ctx neighborhood:876 cooccurence:770 coexpression:967 textmining:822
Rv1599 hisD histidinol dehydrogenase 999 997 ctx neighborhood:876 cooccurence:771 coexpression:918 textmining:882
Rv1600 hisC1 histidinol-phosphate aminotransferase 998 997 ctx neighborhood:876 cooccurence:680 coexpression:920 textmining:567
Rv1604 impA inositol-monophosphatase ImpA 997 983 ctx neighborhood:882 coexpression:860 textmining:879
Rv2121c hisG ATP phosphoribosyltransferase 996 961 ctx cooccurence:705 coexpression:857 textmining:911
Rv1611 trpC indole-3-glycerol phosphate synthase 979 928 database:900 textmining:725
Rv2192c trpD anthranilate phosphoribosyltransferase 961 909 database:900 textmining:599
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 963 886 coexpression:857 textmining:693
Rv3396c guaA GMP synthase 842 777 coexpression:651
Rv3772 hisC2 histidinol-phosphate aminotransferase 791 769 coexpression:692
Rv2231c cobC aminotransferase 778 754 coexpression:693
Rv2202c adoK adenosine kinase 713 702 coexpression:692

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
  • MTBC0 PGAP product: bifunctional 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase/phosphoribosylanthranilate isomerase PriA
  • Pfam (hmmscan --cut_ga): His_biosynth PF00977.28 (E=5e-63)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216119.1)
  • Domains: Pfam-A via hmmscan --cut_ga — His_biosynth (PF00977.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0106
  • Curated reference: UniProt P9WMM5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 58 functional partner(s); context anchor hisF
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001709|Rv1603|hisA
MMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGRGSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGEHGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGGPNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQALAAVRD