cut2 Family assigned · medium auto-curated
H37Rv Rv2301 · MTBC0 mtbc0_002441 ·
230 aa · 2597764–2598456 (+) ·
RefSeq NP_216817.2
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cutinase |
|---|---|
| MTBC0 PGAP re-annotation | cutinase family protein |
| Revised (this work) | Cutinase family protein. Pfam: Cutinase (PF01083.29). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WP41
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable carboxylesterase Culp2 |
| EC (curated) |
EC 3.1.1.-
|
| Curated function | Shows weak esterase activity with the p-nitrophenol-linked aliphatic ester pNP-butyrate. Does not exhibit cutinase activity..; FUNCTION: Induces interferon-gamma (IFN-gamma) release in animal models and in human TB patients. Also induces a strong delayed-type hypersensitivity (DTH) response in animal models. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | cut2 |
| eggNOG description | Catalyzes the hydrolysis of cutin, a polyester that forms the structure of plant cuticle |
| Orthologous group | 2DVMQ |
| EC number |
EC 3.1.1.74
|
| KEGG orthology |
K08095
|
| Gene Ontology (27) |
GO:0005575, GO:0005576, GO:0008150, GO:0009605, GO:0009607, GO:0020012, GO:0030682, GO:0042783, GO:0043207, GO:0044403, GO:0044413, GO:0044415 +15 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.5 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Cutinase | PF01083.29 | 2.5e-48 | 44–229 | Cutinase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: eccD3 (ESX-3 secretion system protein EccD), medium confidence from genomic context alone (score 674 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1278 hyp |
hypothetical protein | 716 | 717 ctx | cooccurence:401 database:544 |
Rv0153c ptbB |
phosphotyrosine protein phosphatase | 694 | 682 | experimental:629 |
Rv0290 eccD3 |
ESX-3 secretion system protein EccD | 674 | 674 ctx | cooccurence:673 |
Rv1747 |
ABC transporter ATP-binding protein/permease | 661 | 648 | database:530 |
Rv1277 hyp |
hypothetical protein | 635 | 636 | database:544 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 648 | 630 | experimental:629 |
Rv2302 hyp |
hypothetical protein | 627 | 627 ctx | neighborhood:560 |
Rv0434 hyp |
hypothetical protein | 609 | 609 | database:561 |
Rv3812 PE_PGRS62 |
PE-PGRS family protein PE_PGRS62 | 601 | 598 | database:543 |
Rv2328 PE23 |
PE family protein PE23 | 601 | 598 | database:543 |
Rv3036c TB22.2 hyp |
hypothetical protein | 601 | 598 | database:543 |
Rv0832 PE_PGRS12 |
PE-PGRS family protein PE_PGRS12 | 601 | 598 | database:543 |
Rv1827 garA |
glycogen accumulation regulator GarA | 596 | 596 | database:530 |
Rv0020c fhaA |
FHA domain-containing protein FhaA | 596 | 596 | database:530 |
Rv3196 hyp |
hypothetical protein | 608 | 594 | database:464 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: cutinase
- MTBC0 PGAP product: cutinase family protein
- Pfam (hmmscan --cut_ga): Cutinase PF01083.29 (E=2e-48)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216817.2)
- Domains: Pfam-A via hmmscan --cut_ga — Cutinase (PF01083.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DVMQ - Curated reference: UniProt P9WP41 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
90 functional partner(s); context anchor
eccD3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002441|Rv2301|cut2 MNDLLTRRLLTMGAAAAMLAAVLLLTPITVPAGYPGAVAPATAACPDAEVVFARGRFEPPGIGTVGNAFVSALRSKVNKNVGVYAVKYPADNQIDVGANDMSAHIQSMANSCPNTRLVPGGYSLGAAVTDVVLAVPTQMWGFTNPLPPGSDEHIAAVALFGNGSQWVGPITNFSPAYNDRTIELCHGDDPVCHPADPNTWEANWPQHLAGAYVSSGMVNQAADFVAGKLQ