cut1 Resolved · high auto-curated
H37Rv Rv1758 · MTBC0 - ·
174 aa ·
1989042–1989566 H37Rv
(+) ·
RefSeq NP_216274.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | cutinase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Cutinase. Pfam: Cutinase (PF01083.29). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 4 publications
4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context, 1 in other mycobacteria — M. marinum (1), M. smegmatis (1)).
| Publication | Date |
|---|---|
| Identification of positively selected genes in Mycobacterium tuberculosis from southern Xinjiang Uygur autonomous region of China. doi:10.3389/fmicb.2024.1290227 | 2024 |
| The MtZ Strain: Molecular Characteristics and Outbreak Investigation of the Most Successful Mycobacterium tuberculosis Strain in Aragon Using Whole-Genome Sequencing. doi:10.3389/fcimb.2022.887134 | 2022 |
| Roles of Triolein and Lipolytic Protein in the Pathogenesis and Survival of Mycobacterium tuberculosis: a Novel Therapeutic Approach. doi:10.1007/s12010-015-1953-z | 2016 |
| Truncated Rv2820c enhances mycobacterial virulence ex vivo and in vivo. doi:10.1016/j.micpath.2011.02.008 | 2011 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 0.68 (95% CI -2.15 to 4.89). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Hydrolysis of cutin. |
|---|---|
| Mycobrowser EC |
3.1.1.-
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1788
· 98.3% identity |
|---|---|
| M. marinum |
MMAR_2419
· 58.9% identity |
| M. smegmatis |
MSMEG_1184
· 58.1% identity |
| M. abscessus |
MAB_3272c
· 52.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O06793
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Probable carboxylesterase Culp5 |
| EC (curated) |
EC 3.1.1.-
|
| Curated function | Does not exhibit cutinase activity. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| Preferred name | cut1 |
| eggNOG description | Cutinase |
| Orthologous group | 2A1QU |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 8 missense, 1 nonsense, 2 frameshift |
| Disruption | 3 distinct premature-stop/frameshift site(s); most common in 6.12% of strains (8894) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.329 (low power)
· 4 consensus substitution(s) low power (4 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 60.0%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 47.3% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 148. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) | -5.05 | 0.0 | required |
| Differential genetic requirements of clinical Mtb strain (ID=630) from Euro-American lineage (compared to H37Rv control) (strain background) | -4.80 | 0.016 | required |
| Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) | -3.29 | 0.013 | required |
| Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) | -3.12 | 0.014 | required |
Conditional fitness of transposon-disruption mutants across 4 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 5 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 17.2 ppm · rank 2416/3519 (31.4th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 174 aa |
|---|---|
| Molecular weight | 17.9 kDa |
| Theoretical pI | 4.7 |
| GRAVY | 0.166 (hydrophobic) |
| Aliphatic index | 75.3 |
| Aromaticity | 0.08 |
| Instability index | 41.8 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Cutinase | PF01083.29 | 1.2e-36 | 8–172 | Cutinase |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.4
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
2axe-assembly1_A |
1.00 | 0.78 | 1.9e-07 sig | 2axe-assembly1_A IODINATED COMPLEX OF ACETYL XYLAN ESTERASE AT 1.80 ANGSTROMS |
1g66-assembly1_A |
1.00 | 0.77 | 2.9e-07 sig | 1g66-assembly1_A ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION |
2czq-assembly2_B |
1.00 | 0.68 | 4.4e-07 sig | 2czq-assembly2_B A novel cutinase-like protein from Cryptococcus sp. |
7cw1-assembly2_B |
1.00 | 0.71 | 1.7e-06 sig | 7cw1-assembly2_B Crystal structure of a biodegradable plastic-degrading cutinase-like enzyme from the phyllosphere yeast, Pseudozyma antarctica, solved by getting the phase from anomalous scattering of uncovalently coordinated arsenic (cacodylate). |
3aja-assembly2_B |
1.00 | 0.55 | 2.5e-05 sig | 3aja-assembly2_B Crystal Structure of MSMEG_6394 |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1754c (- strand, 2371 bp gap) |
|---|---|
| Downstream (3' on genome) | wag22 (- strand, 266 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3637 |
Possible transposase; Rv3637, (MTCY15C10.15c), len: 166 aa. Possible transposase. C-terminal end highly similar to Q9RLQ9|ISTA putative tran | 731 | 731 | coexpression:731 |
Rv0153c ptbB exp |
phosphotyrosine protein phosphatase | 693 | 680 | experimental:629 |
Rv1747 exp |
ABC transporter ATP-binding protein/permease | 660 | 647 | database:530 |
Rv3157 nuoM exp |
NADH-quinone oxidoreductase subunit M | 649 | 631 | experimental:629 |
Rv1726 |
oxidoreductase | 615 | 615 | coexpression:615 |
Rv0434 hyp exp |
hypothetical protein | 608 | 609 | database:561 |
Rv1278 hyp exp |
hypothetical protein | 608 | 608 | database:544 |
Rv0832 PE_PGRS12 exp |
PE-PGRS family protein PE_PGRS12 | 601 | 598 | database:543 |
Rv2328 PE23 exp |
PE family protein PE23 | 601 | 598 | database:543 |
Rv3812 PE_PGRS62 exp |
PE-PGRS family protein PE_PGRS62 | 601 | 598 | database:543 |
Rv3036c TB22.2 hyp exp |
hypothetical protein | 601 | 598 | database:543 |
Rv0020c fhaA exp |
FHA domain-containing protein FhaA | 595 | 595 | database:530 |
Rv3360 hyp exp |
hypothetical protein | 593 | 594 | database:530 |
Rv0019c fhaB exp |
FHA domain-containing protein FhaB | 593 | 594 | database:530 |
Rv1827 garA exp |
glycogen accumulation regulator GarA | 593 | 594 | database:530 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): cutinase
- Pfam (hmmscan --cut_ga): Cutinase PF01083.29 (E=1e-36)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216274.1)
- Domains: Pfam-A via hmmscan --cut_ga — Cutinase (PF01083.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2A1QU - Curated reference: UniProt O06793 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.4)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1758|cut1 MPGRFREDFIDALRSKIGEKSMGVYGVDYPATTDFPTAMAGIYDAGTHVEQTAANCPQSKLVLGGFSQGAAVMGFVTAAAIPDGAPLDAPRPMPPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQLCAPGDPVCSSGGNWAAHNGYADDGMVEQAAVFAAGRLG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for cut1? Email the maintainer — the message is pre-filled with this gene's details.