cut1 Resolved · high auto-curated

H37Rv Rv1758 · MTBC0 - · 174 aa · 1989042–1989566 (+) · RefSeq NP_216274.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cutinase
MTBC0 PGAP re-annotation
Revised (this work)Cutinase. Pfam: Cutinase (PF01083.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O06793 SwissProt · reviewed · Inferred from homology
UniProt nameProbable carboxylesterase Culp5
EC (curated) EC 3.1.1.-
Curated functionDoes not exhibit cutinase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
Preferred namecut1
eggNOG descriptionCutinase
Orthologous group2A1QU

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 8 missense, 1 nonsense, 2 frameshift
Disruption 3 distinct premature-stop/frameshift site(s); most common in 6.12% of strains (8894) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CutinasePF01083.29 1.2e-368–172 Cutinase

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3637 Possible transposase; Rv3637, (MTCY15C10.15c), len: 166 aa. Possible transposase. C-terminal end highly similar to Q9RLQ9|ISTA putative tran 731 731 coexpression:731
Rv0153c ptbB phosphotyrosine protein phosphatase 693 680 experimental:629
Rv1747 ABC transporter ATP-binding protein/permease 660 647 database:530
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 649 631 experimental:629
Rv1726 oxidoreductase 615 615 coexpression:615
Rv0434 hyp hypothetical protein 608 609 database:561
Rv1278 hyp hypothetical protein 608 608 database:544
Rv0832 PE_PGRS12 PE-PGRS family protein PE_PGRS12 601 598 database:543
Rv2328 PE23 PE family protein PE23 601 598 database:543
Rv3812 PE_PGRS62 PE-PGRS family protein PE_PGRS62 601 598 database:543
Rv3036c TB22.2 hyp hypothetical protein 601 598 database:543
Rv0020c fhaA FHA domain-containing protein FhaA 595 595 database:530
Rv3360 hyp hypothetical protein 593 594 database:530
Rv0019c fhaB FHA domain-containing protein FhaB 593 594 database:530
Rv1827 garA glycogen accumulation regulator GarA 593 594 database:530

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): cutinase
  • Pfam (hmmscan --cut_ga): Cutinase PF01083.29 (E=1e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216274.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Cutinase (PF01083.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2A1QU
  • Curated reference: UniProt O06793 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 92 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1758|cut1
MPGRFREDFIDALRSKIGEKSMGVYGVDYPATTDFPTAMAGIYDAGTHVEQTAANCPQSKLVLGGFSQGAAVMGFVTAAAIPDGAPLDAPRPMPPEVADHVAAVTLFGMPSVAFMHSIGAPPIVIGPLYAEKTIQLCAPGDPVCSSGGNWAAHNGYADDGMVEQAAVFAAGRLG