Rv1584c Family assigned · medium
H37Rv Rv1584c · MTBC0 mtbc0_001691 ·
73 aa · 1798267–1798488 (-) ·
RefSeq NP_216100.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | phage protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Prophage phiRv1 recombination-directionality factor (RDF/excisionase). RefSeq leaves it of unknown function. In the phiRv1 prophage-like element, the serine integrase Rv1586c catalyses integration/excision and the small basic Rv1584c protein controls the directionality of recombination (Bibb 2002). |
Curated reference (UniProt)
| UniProt |
O06606
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Possible PhiRv1 phage protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 28RTI |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1583c (phage protein), high confidence from genomic context alone (score 779 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1583c |
phage protein | 780 | 779 ctx | neighborhood:778 |
Rv1582c |
phage protein | 777 | 777 ctx | neighborhood:773 |
Rv1586c |
phage integrase | 857 | 630 ctx | neighborhood:618 textmining:630 |
Rv1587c hyp |
hypothetical protein | 616 | 616 ctx | neighborhood:605 |
Rv1585c |
phage protein | 931 | 612 ctx | neighborhood:605 textmining:830 |
Rv1588c hyp |
hypothetical protein | 608 | 607 ctx | neighborhood:605 |
Rv1581c |
phage protein | 452 | 452 ctx | neighborhood:447 |
Rv1579c |
phage protein | 439 | 439 ctx | neighborhood:436 |
Rv1580c |
phage protein | 439 | 438 ctx | neighborhood:436 |
Rv2657c |
prophage protein | 464 | 96 | textmining:432 |
Rv0595c vapC4 |
ribonuclease VapC4 | 437 | 50 | textmining:432 |
Rv2310 |
excisionase | 870 | 47 | textmining:870 |
Rv1573 |
phage protein | 517 | 47 | textmining:514 |
Rv3750c vapB50 |
excisionase | 698 | 46 | textmining:697 |
Rv1802 PPE30 |
PPE family protein PPE30 | 442 | 46 | textmining:440 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- phiRv1 prophage; small basic protein controlling recombination directionality (Bibb 2002, PMID 12354222)
- Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216100.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28RTI - Curated reference: UniProt O06606 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
21 functional partner(s); context anchor
Rv1583c - Primary literature: Bibb LA, Hatfull GF (2002). Integration and excision of the Mycobacterium tuberculosis prophage-like element, phiRv1 Mol Microbiol 45(6):1515-26. doi:10.1046/j.1365-2958.2002.03130.x PMID:12354222
Ancestral MTBC0 protein sequence
>mtbc0_001691|Rv1584c| MSTIYHHRGRVAALSRSRASDDPEFIAAKTDLVAANIADYLIRTLAAAPPLTDEQRTRLAELLRPVRRSGGAR