Rv1584c Family assigned · medium

H37Rv Rv1584c · MTBC0 mtbc0_001691 · 73 aa · 1798267–1798488 (-) · RefSeq NP_216100.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Prophage phiRv1 recombination-directionality factor (RDF/excisionase). RefSeq leaves it of unknown function. In the phiRv1 prophage-like element, the serine integrase Rv1586c catalyses integration/excision and the small basic Rv1584c protein controls the directionality of recombination (Bibb 2002).

Curated reference (UniProt)

UniProt O06606 TrEMBL · unreviewed · Predicted
UniProt namePossible PhiRv1 phage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28RTI

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1583c (phage protein), high confidence from genomic context alone (score 779 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1583c phage protein 780 779 ctx neighborhood:778
Rv1582c phage protein 777 777 ctx neighborhood:773
Rv1586c phage integrase 857 630 ctx neighborhood:618 textmining:630
Rv1587c hyp hypothetical protein 616 616 ctx neighborhood:605
Rv1585c phage protein 931 612 ctx neighborhood:605 textmining:830
Rv1588c hyp hypothetical protein 608 607 ctx neighborhood:605
Rv1581c phage protein 452 452 ctx neighborhood:447
Rv1579c phage protein 439 439 ctx neighborhood:436
Rv1580c phage protein 439 438 ctx neighborhood:436
Rv2657c prophage protein 464 96 textmining:432
Rv0595c vapC4 ribonuclease VapC4 437 50 textmining:432
Rv2310 excisionase 870 47 textmining:870
Rv1573 phage protein 517 47 textmining:514
Rv3750c vapB50 excisionase 698 46 textmining:697
Rv1802 PPE30 PPE family protein PPE30 442 46 textmining:440

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • phiRv1 prophage; small basic protein controlling recombination directionality (Bibb 2002, PMID 12354222)
  • Curated from the literature crible (project 'Still unknown gene function', 2026-06-09)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216100.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28RTI
  • Curated reference: UniProt O06606 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor Rv1583c
  • Primary literature: Bibb LA, Hatfull GF (2002). Integration and excision of the Mycobacterium tuberculosis prophage-like element, phiRv1 Mol Microbiol 45(6):1515-26. doi:10.1046/j.1365-2958.2002.03130.x PMID:12354222

Ancestral MTBC0 protein sequence

>mtbc0_001691|Rv1584c|
MSTIYHHRGRVAALSRSRASDDPEFIAAKTDLVAANIADYLIRTLAAAPPLTDEQRTRLAELLRPVRRSGGAR