fbpC Resolved · high auto-curated

H37Rv Rv0129c · MTBC0 - · 340 aa · 156578–157600 (-) · RefSeq YP_177694.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diacylglycerol acyltransferase/mycolyltransferase Ag85C
MTBC0 PGAP re-annotation
Revised (this work)Diacylglycerol acyltransferase/mycolyltransferase Ag85C. Pfam: Esterase (PF00756.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQN9 SwissProt · reviewed · Evidence at protein level
UniProt nameDiacylglycerol acyltransferase/mycolyltransferase Ag85C
EC (curated) EC 2.3.1.122, EC 2.3.1.20
Curated functionThe antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecmtB
eggNOG descriptionfibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM
Orthologous groupCOG0627
EC number EC 2.3.1.122, EC 2.3.1.20
KEGG orthology K18851
KEGG pathways map00561, map01100
KEGG modules M00089
Gene Ontology (54) GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006629, GO:0006643, GO:0006664, GO:0006810 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.322 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EsterasePF00756.27 1.0e-7061–321 Putative esterase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aftB (terminal beta-(1->2)-arabinofuranosyltransferase), high confidence from genomic context alone (score 820 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3804c fbpA diacylglycerol acyltransferase/mycolyltransferase Ag85A 974 903 database:900 textmining:747
Rv1886c fbpB diacylglycerol acyltransferase/mycolyltransferase Ag85B 973 902 database:900 textmining:738
Rv3097c lipY triacylglycerol lipase Lip 904 901 database:900
Rv2252 dagK diacylglycerol kinase 900 901 database:900
Rv3810 pirG cell surface protein 853 852 coexpression:765
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 819 820 ctx cooccurence:600 database:500
Rv3802c membrane protein 800 778 ctx cooccurence:743
Rv3258c hyp hypothetical protein 740 740 coexpression:740
Rv3668c protease 719 719 ctx cooccurence:717
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 709 709 ctx cooccurence:708
Rv1476 membrane protein 684 685 ctx cooccurence:679
Rv3244c lpqB lipoprotein LpqB 677 678 ctx cooccurence:673
Rv0412c glnX membrane protein 683 671 ctx cooccurence:445 coexpression:414
Rv3444c esxT ESAT-6 like protein EsxT 690 651 ctx cooccurence:650
Rv3035 hyp hypothetical protein 646 646 ctx cooccurence:642

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): diacylglycerol acyltransferase/mycolyltransferase Ag85C
  • Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=1e-70)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177694.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0627
  • Curated reference: UniProt P9WQN9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor aftB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0129c|fbpC
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA