fbpC Resolved · high auto-curated

H37Rv Rv0129c · MTBC0 - · 340 aa · 156578–157600 H37Rv (-) · RefSeq YP_177694.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)diacylglycerol acyltransferase/mycolyltransferase Ag85C
MTBC0 PGAP re-annotation
Revised (this work)Diacylglycerol acyltransferase/mycolyltransferase Ag85C. Pfam: Esterase (PF00756.27).
Functional category (TubercuList)lipid metabolism

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

In the literature (TB corpus sweep) 26 publications

26 TB publications mention this gene. 26 publication(s) discuss this gene (24 in a M. tuberculosis context, 2 in other mycobacteria — M. smegmatis (2)).

Most recent 5 of 26.
PublicationDate
Enhanced removal of Cr (VI) in constructed wetland with Fe-Ni-LDH-modified crayfish shell biochar: Performance, removal pathways and synergy mechanisms of substrate-microorganism. doi:10.1016/j.jhazmat.2025.139724 2025
Comparative Analysis of Virulence Genes in Non-Tuberculosis Mycobacteria (NTM) Isolated from Kenyan Camel Milk Suggests Potential Pathogenicity. doi:10.1007/s00284-025-04244-8 2025
Improving the biotransformation efficiency of soybean phytosterols in Mycolicibacterium neoaurum by the combined deletion of fbpC3 and embC in cell envelope synthesis. doi:10.1016/j.synbio.2021.11.007 2022
Identification of B cell antigenome in Mycobacterium bovis by immunoproteomic analysis. doi:10.1556/004.2020.00019 2020
Intranasal vaccination with Listeria ivanovii as vector of Mycobacterium tuberculosis antigens promotes specific lung-localized cellular and humoral immune responses. doi:10.1038/s41598-019-57245-6 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Intrinsic disorder (sequence + structure) partially disordered

Predicted disorder17% of residues (metapredict) · mean AlphaFold pLDDT 87.8
Disordered regions1 IDR(s), longest 45 aa [0-45]

carries a substantial disordered region (45/340 residues); disorder is a property, not a function

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Conditional expression context (iModulons)

Member of 2 independently-modulated gene set(s): SigH (sigH), Rv1828/SigH (Rv1828 or sigH).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 1.10 (95% CI -0.64 to 3.98). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionProteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity.
Mycobrowser EC 2.3.1.- · superseded EC numbering; the atlas uses the current class (2.3.1.122, 2.3.1.20)

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0134c · 100.0% identity
M. leprae ML2655 · 82.3% identity
M. marinum MMAR_0328 · 89.0% identity
M. smegmatis MSMEG_3580 · 74.7% identity
M. orygis RJtmp_000140 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WQN9 SwissProt · reviewed · Evidence at protein level
UniProt nameDiacylglycerol acyltransferase/mycolyltransferase Ag85C
EC (curated) EC 2.3.1.122, EC 2.3.1.20
Curated functionThe antigen 85 proteins (FbpA, FbpB, FbpC) are responsible for the high affinity of mycobacteria to fibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namecmtB
eggNOG descriptionfibronectin, a large adhesive glycoprotein, which facilitates the attachment of M.tuberculosis to murine alveolar macrophages (AMs). They also help to maintain the integrity of the cell wall by catalyzing the transfer of mycolic acids to cell wall arabinogalactan, and through the synthesis of alpha,alpha-trehalose dimycolate (TDM, cord factor). They catalyze the transfer of a mycoloyl residue from one molecule of alpha,alpha-trehalose monomycolate (TMM) to another TMM, leading to the formation of TDM
Orthologous groupCOG0627
EC number EC 2.3.1.122, EC 2.3.1.20
KEGG orthology K18851
KEGG pathways map00561, map01100
KEGG modules M00089
Gene Ontology (54) GO:0003674, GO:0003824, GO:0005488, GO:0005515, GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0006629, GO:0006643, GO:0006664, GO:0006810 +42 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.322 · quasi-invariant (6 sites), pN/pS sous-puissant
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Corynebacteriales

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 85.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 44.9%
detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 28 in the ORF — 0 in the essential state, 0 growth-defect, 28 non-essential, 0 growth-advantage. Saturation 0.929, mean read count 139.923076923. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
All 28 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
fitness after prolonged in vitro passage (in vitro passage) -3.520.0 required
altered fitness under Rifampicin (drug exposure) -2.180.0 required
altered fitness under Vancomycin (drug exposure) -1.890.0 required

Conditional fitness of transposon-disruption mutants across 3 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 16 of 16 independent MS datasets
Integrated abundance1279.0 ppm · rank 170/3519 (95.2th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length340 aa
Molecular weight36.8 kDa
Theoretical pI5.92
GRAVY-0.253 (hydrophilic)
Aliphatic index69.0
Aromaticity0.124
Instability index49.3 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
EsterasePF00756.27 1.0e-7061–321 Putative esterase

Experimental structures (Protein Data Bank) 18 solved

PDBMethodResolutionCoverage
4qek X-ray diffraction 1.299 Å 100%
4mql X-ray diffraction 1.3 Å 100%
5kwi X-ray diffraction 1.3 Å 100%
4mqm X-ray diffraction 1.346 Å 100%
4qe3 X-ray diffraction 1.351 Å 100%
4qdu X-ray diffraction 1.4 Å 100%
5vns X-ray diffraction 1.45 Å 100%
4qdt X-ray diffraction 1.498 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (18 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 87.8

PDB hitprobTM-scoreE-valueDescription
3hrh-assembly1_B 1.00 1.00 2.9e-56 sig 3hrh-assembly1_B Crystal Structure of Antigen 85C and Glycerol
1dqz-assembly1_B 1.00 0.99 9.0e-56 sig 1dqz-assembly1_B CRYSTAL STRUCTURE OF ANTIGEN 85C FROM MYCOBACTERIUM TUBERCULOSIS
5vns-assembly1_A 1.00 0.98 3.0e-55 sig 5vns-assembly1_A M.tb Antigen 85C Acyl-Enzyme Intermediate with Tetrahydrolipstatin
4qdz-assembly1_A 1.00 0.98 1.6e-53 sig 4qdz-assembly1_A Crystal structure of Antigen 85C-E228Q mutant
4qek-assembly1_A 1.00 0.96 1.9e-54 sig 4qek-assembly1_A Crystal structure of Antigen 85C-S124A mutant

Foldseek search of the AlphaFold DB model (mean pLDDT 87.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0128 (+ strand, 131 bp gap)
Downstream (3' on genome)htdZ (+ strand, 246 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: aftB (terminal beta-(1->2)-arabinofuranosyltransferase), high confidence from genomic context alone (score 820 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3804c fbpA exp diacylglycerol acyltransferase/mycolyltransferase Ag85A 974 903 database:900 textmining:747
Rv1886c fbpB exp diacylglycerol acyltransferase/mycolyltransferase Ag85B 973 902 database:900 textmining:738
Rv3097c lipY exp triacylglycerol lipase Lip 904 901 database:900
Rv2252 dagK exp diacylglycerol kinase 900 901 database:900
Rv3810 pirG cell surface protein 853 852 coexpression:765
Rv3805c aftB exp terminal beta-(1->2)-arabinofuranosyltransferase 819 820 ctx cooccurence:600 database:500
Rv3802c membrane protein 800 778 ctx cooccurence:743
Rv3258c hyp hypothetical protein 740 740 coexpression:740
Rv3668c protease 719 719 ctx cooccurence:717
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 709 709 ctx cooccurence:708
Rv1476 membrane protein 684 685 ctx cooccurence:679
Rv3244c lpqB lipoprotein LpqB 677 678 ctx cooccurence:673
Rv0412c glnX membrane protein 683 671 ctx cooccurence:445 coexpression:414
Rv3444c esxT ESAT-6 like protein EsxT 690 651 ctx cooccurence:650
Rv3035 hyp hypothetical protein 646 646 ctx cooccurence:642

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): diacylglycerol acyltransferase/mycolyltransferase Ag85C
  • Pfam (hmmscan --cut_ga): Esterase PF00756.27 (E=1e-70)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177694.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Esterase (PF00756.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0627
  • Curated reference: UniProt P9WQN9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 87.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 82 functional partner(s); context anchor aftB
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0129c|fbpC
MTFFEQVRRLRSAATTLPRRLAIAAMGAVLVYGLVGTFGGPATAGAFSRPGLPVEYLQVPSASMGRDIKVQFQGGGPHAVYLLDGLRAQDDYNGWDINTPAFEEYYQSGLSVIMPVGGQSSFYTDWYQPSQSNGQNYTYKWETFLTREMPAWLQANKGVSPTGNAAVGLSMSGGSALILAAYYPQQFPYAASLSGFLNPSEGWWPTLIGLAMNDSGGYNANSMWGPSSDPAWKRNDPMVQIPRLVANNTRIWVYCGNGTPSDLGGDNIPAKFLEGLTLRTNQTFRDTYAADGGRNGVFNFPPNGTHSWPYWNEQLVAMKADIQHVLNGATPPAAPAAPAA