Rv1780 Family assigned · low

H37Rv Rv1780 · MTBC0 mtbc0_001894 · 187 aa · 2032710–2033273 (+) · RefSeq NP_216296.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)BPI/SPLUNC1-like lipid-binding fold (PDB 5I7L); putative lipid-binding protein.

Curated reference (UniProt)

UniProt O53931 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ESGC

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.34 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 90.9 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5i7l-assembly3_A 1.00 0.60 4.8e-04 sig 5i7l-assembly3_A Crystal Structure of SPLUNC1 Disulfide Mutant M2 (A48C, V253C)
6baq-assembly3_C 1.00 0.62 1.9e-03 sig 6baq-assembly3_C Mus musculus BPIFA1
6baq-assembly1_A 1.00 0.58 2.2e-03 sig 6baq-assembly1_A Mus musculus BPIFA1
6baq-assembly2_B 1.00 0.57 2.1e-03 sig 6baq-assembly2_B Mus musculus BPIFA1
6baq-assembly8_H 1.00 0.49 1.4e-03 sig 6baq-assembly8_H Mus musculus BPIFA1
6baq-assembly6_F 1.00 0.54 2.4e-03 sig 6baq-assembly6_F Mus musculus BPIFA1
6baq-assembly7_G 0.99 0.42 1.6e-03 sig 6baq-assembly7_G Mus musculus BPIFA1
6baq-assembly5_E 0.99 0.45 4.9e-03 sig 6baq-assembly5_E Mus musculus BPIFA1

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lipE (lipase LipE), medium confidence from genomic context alone (score 644 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2042c hyp hypothetical protein 757 757 ctx cooccurence:725
Rv2342 hyp hypothetical protein 756 756 ctx cooccurence:755
Rv3707c hyp hypothetical protein 670 670 ctx cooccurence:670
Rv0817c lmeA hyp hypothetical protein 668 668 ctx cooccurence:668
Rv0466 hyp hypothetical protein 653 653 ctx cooccurence:652
Rv3775 lipE lipase LipE 644 644 ctx cooccurence:641
Rv1125 hyp hypothetical protein 636 636 ctx cooccurence:636
Rv0479c membrane protein 627 628 ctx cooccurence:624
Rv0185 hyp hypothetical protein 615 615 ctx cooccurence:615
Rv0356c hyp hypothetical protein 589 589 ctx cooccurence:589
Rv0383c ttfA hyp hypothetical protein 571 571 ctx cooccurence:571
Rv1610 membrane protein 545 545 ctx cooccurence:545
Rv1371 membrane protein 540 540 ctx cooccurence:540
Rv3035 hyp hypothetical protein 527 527 ctx cooccurence:526
Rv0184 hyp hypothetical protein 524 524 ctx cooccurence:524

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 5i7l-assembly3_A Crystal Structure of SPLUNC1 Disulfide Mutant M2 (A48C, V253C) (prob 1.00, E=5e-04, TM=0.60)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216296.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ESGC
  • Curated reference: UniProt O53931 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 90.9, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor lipE
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001894|Rv1780|
MQNHDYVTYEEFGRRFFEVAVTPDRVAAAFADIAGSEFAMEPISQGPGGIAKVSANVKIREPRVTRKLGDLITFVIHIPLSIDLLLDLRLDKQRFMVAGDIALRATARAAEPLLLIVDVAKPRPSDITVNVSSKSIRGEVLRILAGVDGEIRRFIAQYVSAEIDSPKSQAAQVINVAEQLDSTWSGP