Rv1578c Family assigned · medium auto-curated

H37Rv Rv1578c · MTBC0 mtbc0_001685 · 156 aa · 1794719–1795189 (-) · RefSeq NP_216094.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)phage protein
MTBC0 PGAP re-annotationphage terminase small subunit P27 family
Revised (this work)Phage terminase small subunit P27 family. Pfam: Terminase_4 (PF05119.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06612 TrEMBL · unreviewed · Predicted
UniProt nameProbable PhiRv1 phage protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
eggNOG descriptionPhage terminase, small subunit
Orthologous groupCOG3747

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.128 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Terminase_4PF05119.18 2.3e-2848–144 Phage terminase, small subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1576c (phage capsid protein), medium confidence from genomic context alone (score 675 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1576c phage capsid protein 687 675 ctx neighborhood:478
Rv1577c phage prohead protease 665 646 ctx neighborhood:478
Rv1582c phage protein 583 583
Rv1579c phage protein 563 563 ctx neighborhood:557
Rv1580c phage protein 560 560 ctx neighborhood:557
Rv1588c hyp hypothetical protein 549 549
Rv1587c hyp hypothetical protein 547 547
Rv1581c phage protein 545 546 ctx neighborhood:543
Rv0613c hyp hypothetical protein 469 469 ctx cooccurence:469
Rv2650c prophage protein 441 421
Rv2651c prophage protease 443 413
Rv1749c integral membrane protein 401 401 ctx cooccurence:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: phage protein
  • MTBC0 PGAP product: phage terminase small subunit P27 family
  • Pfam (hmmscan --cut_ga): Terminase_4 PF05119.18 (E=2e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216094.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Terminase_4 (PF05119.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3747
  • Curated reference: UniProt O06612 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv1576c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001685|Rv1578c|
MPRPPKPARLKLVEGRSPGRDSGGRKVPESPKFIRQAPDAPDWLDAEALAEWRRVAPTLERLDLLKPEDRALLSAYCETWSVYVAAVQRVRAEGLTITSPKSGVVHRNPAVTVAETARMHLLRLASEFGLTPAAEQRLAVAPGDDGDGLNPFAPDR